DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7551 and AT4G10260

DIOPT Version :9

Sequence 1:NP_648466.1 Gene:CG7551 / 39280 FlyBaseID:FBgn0036161 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_192764.1 Gene:AT4G10260 / 826617 AraportID:AT4G10260 Length:324 Species:Arabidopsis thaliana


Alignment Length:334 Identity:68/334 - (20%)
Similarity:120/334 - (35%) Gaps:77/334 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VLCIGTTTIDFVSTIKRFPEEN--SHQKVIGGYWIRGGKASNNCTVLANLGVKVEFLGMLSSWSV 79
            ::..|...||||      |:.:  |..:..|.....||..:|....:..||.|..|:|.......
plant     7 IVSFGEMLIDFV------PDTSGVSLAESTGFLKAPGGAPANVACAITKLGGKSAFIGKFGDDEF 65

  Fly    80 FQVLVDDLKSRGIIIDN-CPTCDQGAPFSSVILTKATKTRNIVYCNNNFPY------VSIDDFRK 137
            ..:||:.||..|:..:. |...:.....:.|.|.|..:...:.|.|.:...      ::.|..:|
plant    66 GHMLVNILKKNGVNSEGVCFDTNARTALAFVTLKKDGEREFMFYRNPSADMLLKESELNKDLIKK 130

  Fly   138 LNLNQYGWIHIRALYFDKSLPMVKD------IEAYNANRKEKIVLSMEFDNNLD-DMWPLMDYC- 194
            ..:..||           |:.::.:      :.|....:...::||  :|.|:. .:||..:.. 
plant   131 AKIFHYG-----------SISLISEPCRTAHMAAMKTAKDAGVLLS--YDPNVRLPLWPSTEAAI 182

  Fly   195 -----------------DYAVFSKKLAQPNGWVSLEDACMQL-DERLRMRWGLNLKRPYVVVLWG 241
                             |...|..:     |....:|..:.| .::|::          ::|..|
plant   183 EGIKSIWNEADIIKVSDDEVTFLTR-----GDAEKDDVVLSLMHDKLKL----------LIVTDG 232

  Fly   242 DQGAGILDLNGNFTHVKPHKPKRIVDALGAGDTFVGAFIYAL------YIRERSVSVAVDFGNRM 300
            ::|...  ....|....|....:.||..||||:|||||:.:|      ...|..:..|:.|.|..
plant   233 EKGCRY--YTKKFKGRVPGYAVKAVDTTGAGDSFVGAFLVSLGKDGSILDDEGKLKEALAFANAC 295

  Fly   301 ASYKCTKNG 309
            .:...|:.|
plant   296 GAVCTTQKG 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7551NP_648466.1 Ketohexokinase 16..311 CDD:238914 68/334 (20%)
AT4G10260NP_192764.1 PLN02323 1..324 CDD:215183 68/334 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43085
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.