DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7551 and CG3809

DIOPT Version :9

Sequence 1:NP_648466.1 Gene:CG7551 / 39280 FlyBaseID:FBgn0036161 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_731676.2 Gene:CG3809 / 41476 FlyBaseID:FBgn0037995 Length:396 Species:Drosophila melanogaster


Alignment Length:116 Identity:29/116 - (25%)
Similarity:49/116 - (42%) Gaps:13/116 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 LMDYCDYAVFSKK----LAQPNGWVSLEDACMQLDERLRMRWGLNLKRPYVVVLWGDQGAGILDL 250
            ::.|.|..:.:|:    .:..|.|.:..  ..::..||:.....| .||.:|:: .|....:|..
  Fly   260 ILQYVDIIICNKEEAIAFSDTNDWKTKN--IFEIGSRLQQMPKEN-TRPRLVMI-TDAVCPVLVF 320

  Fly   251 NGNFT----HVKPHKPKRIVDALGAGDTFVGAFIYALYIRERSVSVAVDFG 297
            ..|..    .|.|.|...|.|..|.||.|||.|: |:|::...:...:..|
  Fly   321 QDNDRVLEYPVPPVKQGEIFDTNGCGDAFVGGFL-AMYVQRMPLDYCIRTG 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7551NP_648466.1 Ketohexokinase 16..311 CDD:238914 29/116 (25%)
CG3809NP_731676.2 PTZ00247 50..392 CDD:240328 29/116 (25%)
adenosine_kinase 54..382 CDD:238573 29/116 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456457
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.