DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7551 and CG7335

DIOPT Version :9

Sequence 1:NP_648466.1 Gene:CG7551 / 39280 FlyBaseID:FBgn0036161 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_649180.1 Gene:CG7335 / 40203 FlyBaseID:FBgn0036941 Length:372 Species:Drosophila melanogaster


Alignment Length:341 Identity:98/341 - (28%)
Similarity:155/341 - (45%) Gaps:56/341 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KKTVLCIGTTTIDFVSTI--KRFPEENSHQKVIGGYWIRGGKASNNCTVLANLGVKVEFLGMLSS 76
            |:.||.:|:.|:|.::.:  ..||  ...|:...|.|.|||.|:|.|||...||::.||||:||.
  Fly    30 KRHVLAVGSCTLDMITIVDLPLFP--GQVQRTTEGSWRRGGPAANICTVWRRLGLECEFLGVLSR 92

  Fly    77 WSVFQVLVDDLKSRGIIIDNCPTCDQGAPFSSVILTKATKTRNIV-YCNNN-----FPYVSIDDF 135
            ...|:.|::..:|:||.|.:||..:......|:|:.:...||.:: :.|.|     ..:|...|:
  Fly    93 VRAFESLLNGFQSQGIDISHCPLTNHRPAHRSIIVQRNVDTRTMLEFANANQELTYQQFVGAVDY 157

  Fly   136 RKLNLNQYGWIHIRALYFDKSLPMVKDIEAYNANRKE-KIVLSMEFDNNLDDMWPLMDYCDYAVF 199
            :|     |.|||.......:.|.||..:..:|....| :|.||::.||.......:....|| ||
  Fly   158 QK-----YSWIHFECRNPVEMLRMVLAVIQFNERCPESRITLSVDLDNLRPATMLMASMVDY-VF 216

  Fly   200 SKKLAQ-----PNG----WVSLEDACMQLDERLRMRWGLN--LKRPYV----------------- 236
            ::|...     .||    |....:.     .|.|.:|..:  .|.||:                 
  Fly   217 ARKTMMRTYCFMNGREVVWAIRNEM-----RRARTQWEKSQPKKMPYLPPDPPDEHSNGYCPGPL 276

  Fly   237 ----VVLWGD--QGAGILDLNGNFTHVKPHKPKRIVDALGAGDTFVGAFIYALYIRERSVSVAVD 295
                ||::.:  :||..|..:..:..|....|.::||.:...|||..|.||||...:..:..|::
  Fly   277 NNQPVVIYNNYMEGASCLMADDTYFKVGSQIPPKLVDVVAVNDTFSAAVIYALIKVKMRLRDAIE 341

  Fly   296 FGNRMASYKCTKNGYD 311
            :|.|.:|.|.|.||:|
  Fly   342 YGTRASSLKLTGNGFD 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7551NP_648466.1 Ketohexokinase 16..311 CDD:238914 96/337 (28%)
CG7335NP_649180.1 Ketohexokinase 32..357 CDD:238914 96/337 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468963
Domainoid 1 1.000 71 1.000 Domainoid score I506
eggNOG 1 0.900 - - E1_KOG2947
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I400
Isobase 1 0.950 - 0 Normalized mean entropy S6304
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1008502at2759
OrthoFinder 1 1.000 - - FOG0003629
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43085
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.