DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7551 and KHK

DIOPT Version :9

Sequence 1:NP_648466.1 Gene:CG7551 / 39280 FlyBaseID:FBgn0036161 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_006712071.1 Gene:KHK / 3795 HGNCID:6315 Length:371 Species:Homo sapiens


Alignment Length:330 Identity:80/330 - (24%)
Similarity:130/330 - (39%) Gaps:103/330 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KKTVLCIGTTTIDFVSTIKRFPEENSHQKVIGGYWIRGGKASNNCTVLANLGVKVEFLGMLS--- 75
            :|.:||:|...:|.:|.:.::|:|:|..:.:...|.|||.|||:||||:.||....|:|.::   
Human     3 EKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGH 67

  Fly    76 -----------------SWSVFQV--------------------------LVDDLKSRGIIIDNC 97
                             .::|||.                          ||.|.:.||:.:...
Human    68 VADSFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDSFLVADFRRRGVDVSQV 132

  Fly    98 PTCDQG-APFSSVILTKATKTRNIVYCNNNFPYVSIDDFRKLNLNQYGWIHIRALYFDKSLPMVK 161
            ....:| .|.|..|:..:...|.||..:.:.|.||..||.|::|.|:.||||......:.:.|::
Human   133 AWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQ 197

  Fly   162 DIEAYNANR--KEKIVLSMEFDNNLDDMWPLMDYCDY--AVFSKKLAQP---------------- 206
            .|:|:|..:  ::||.:|:|.:...::::.|..|.|.  |.||..|..|                
Human   198 RIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVGAPFSLSLPLPANLVLKGSQNPFILPT 262

  Fly   207 ------NGWVSLEDACMQLDER--------------------LRMRW----------GLNLKRPY 235
                  .|.|..||....|.:|                    |..||          .:.||:|.
Human   263 TIGIVVPGLVVFEDGGWGLKQRSRPLALGSSAGLSSEQGVECLHPRWVHRCKNAQRAWVGLKQPQ 327

  Fly   236 VVVLW 240
            ...:|
Human   328 GKPVW 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7551NP_648466.1 Ketohexokinase 16..311 CDD:238914 79/328 (24%)
KHKXP_006712071.1 ribokinase_pfkB_like 5..>235 CDD:294126 61/229 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158959
Domainoid 1 1.000 177 1.000 Domainoid score I3600
eggNOG 1 0.900 - - E1_KOG2947
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I4031
Isobase 1 0.950 - 0 Normalized mean entropy S6304
OMA 1 1.010 - - QHG53391
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003629
OrthoInspector 1 1.000 - - otm41108
orthoMCL 1 0.900 - - OOG6_104955
Panther 1 1.100 - - O PTHR43085
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4048
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.710

Return to query results.
Submit another query.