DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7551 and CG2794

DIOPT Version :9

Sequence 1:NP_648466.1 Gene:CG7551 / 39280 FlyBaseID:FBgn0036161 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_608533.1 Gene:CG2794 / 33233 FlyBaseID:FBgn0031265 Length:700 Species:Drosophila melanogaster


Alignment Length:394 Identity:70/394 - (17%)
Similarity:126/394 - (31%) Gaps:126/394 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AVGKKTVLCIGTTTIDFVSTIKRFPEENSHQKVIGGYW------IRGGKASNNCTVLANLGVKVE 69
            |:.||. |.:|.:.:|....:   .::....|:.|..:      ..||...|....:..|...|.
  Fly   341 AIDKKP-LVVGASILDLSFKV---DDQKRDMKLDGATYSAVAKQAAGGVGRNIAEGIYKLYGDVN 401

  Fly    70 FLGMLSSWSVFQVLVDDLKSRGIIIDNCPTCDQGAPFSSVILTKATKTRNIVYCNNNFPYVSI-- 132
            .:..:.:..:.|.|:.                        ::.||.|...||..|:|....|:  
  Fly   402 LISAVGNDQMGQTLLQ------------------------MMPKALKRGLIVADNHNTSLCSLIF 442

  Fly   133 DDFR--KL---NLNQYGWIHIRALYFDKSLPMVKDIEAYNANRKEKIVLSMEFDNNLDDMWPLMD 192
            |.|.  ||   |:..:..|....|.....|.....:...::|..|:.:.|:.....::.:....:
  Fly   443 DKFGDCKLILGNMEIHQSITAETLQAHHQLFREAPLIIMDSNISEQAMASILQQAQINKIPVFFE 507

  Fly   193 YCDYAVFSK------------KLAQPNGWVSLEDACMQ----LDERL---RMRWGLNLKRPY--- 235
            ..|..:..|            :|.:||         ||    :.|.:   .::|....|:|.   
  Fly   508 PTDMFIAGKPFKLLPELTKNIRLIKPN---------MQELKTITEAITGETVKWNPETKQPQTEL 563

  Fly   236 -----------------VVVLWGDQGAGILDLNGNFTH-----------VKPHKPK--------R 264
                             ::....|.|. :|...|:..:           ..||..:        .
  Fly   564 VQQAKSLIKKIDSHFNCIIATLSDHGV-LLSYRGDAENDARLLLDVSKPTPPHSTRFYPAPMVHN 627

  Fly   265 IVDALGAGDTFVGAFIYALYIRERSVSVAVDFG----------------NRMASYKCTKNGYDHI 313
            ||:..||||:|...||.|| :|.||:...:..|                ...::.:..::.|.|.
  Fly   628 IVNVSGAGDSFCAGFITAL-LRGRSLDECIAGGFVAAERALQSESAVPATYFSNQESFESRYKHT 691

  Fly   314 ANIL 317
            |.|:
  Fly   692 ARII 695

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7551NP_648466.1 Ketohexokinase 16..311 CDD:238914 63/381 (17%)
CG2794NP_608533.1 Indigoidine_A 34..324 CDD:282130
YeiC_kinase_like 345..669 CDD:238916 64/362 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456447
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.