DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7551 and adkb

DIOPT Version :9

Sequence 1:NP_648466.1 Gene:CG7551 / 39280 FlyBaseID:FBgn0036161 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_942097.1 Gene:adkb / 322229 ZFINID:ZDB-GENE-030131-948 Length:345 Species:Danio rerio


Alignment Length:341 Identity:74/341 - (21%)
Similarity:124/341 - (36%) Gaps:113/341 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTQYGHKLSWAVGKKTVLCIGTTTIDFVSTIKRFPEENSHQKVIGGYWIRGGKASNNC------- 58
            |.|..||::...|     ||||   |....|.:.....:|  |...|:.:..:.:..|       
Zfish    76 MIQEPHKVATFFG-----CIGT---DHFGEILKQKAAEAH--VDAHYYEQNQEPTGTCAACITGD 130

  Fly    59 --TVLANLGV-----KVEFLGMLSSWSVFQVLVDDLKSR-----GIIIDNCPTCDQGAPFSSVIL 111
              :::|||..     |.:.|.:..:||:.:      |:|     |..:       ..:|.|.:.:
Zfish   131 NRSLVANLAAANCYNKEKHLDIDRNWSLVE------KARVYYIAGFFL-------TVSPDSILKV 182

  Fly   112 TKATKTRNIVY-CNNNFPYVSIDDFRKLNLNQYGWIHIRALYFDKSLPMVKDIEAYNANRKEKIV 175
            .|.....|.:: .|.:.|::|  .|.|..|.             |.||.|..|            
Zfish   183 AKHASDNNKIFGLNLSAPFIS--QFSKEPLM-------------KVLPYVDII------------ 220

  Fly   176 LSMEFDNNLDDMWPLMDYCDYAVFSKKLAQPNGWVSLEDACMQLDERLRMRWGLNLKRPYVVVLW 240
                |.|.          .:.|.|:|:    .|: ..||.. ::..|::....:|..|..:||..
Zfish   221 ----FGNE----------TEAATFAKE----QGF-ETEDIA-EIAHRVQNLPKVNKNRQRIVVFT 265

  Fly   241 ----------GDQGA--GILDLNGNFTHVKPHKPKRIVDALGAGDTFVGAFIYALYIRERSVSVA 293
                      ||:..  .:||::.|          .|||..||||.|||.|:.|| ::::.:...
Zfish   266 QGREDTVATVGDKVKMFPVLDIDQN----------DIVDTNGAGDAFVGGFLSAL-VQDQPLEEC 319

  Fly   294 VDFGNRMASYKCTKNG 309
            :..|:..|.....::|
Zfish   320 IRAGHYAAHVIIRRSG 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7551NP_648466.1 Ketohexokinase 16..311 CDD:238914 69/326 (21%)
adkbNP_942097.1 PTZ00247 2..344 CDD:240328 74/341 (22%)
ribokinase_pfkB_like 12..344 CDD:294126 74/341 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.