DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7551 and CG13369

DIOPT Version :9

Sequence 1:NP_648466.1 Gene:CG7551 / 39280 FlyBaseID:FBgn0036161 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_569850.1 Gene:CG13369 / 31007 FlyBaseID:FBgn0025640 Length:304 Species:Drosophila melanogaster


Alignment Length:347 Identity:71/347 - (20%)
Similarity:119/347 - (34%) Gaps:100/347 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VLCIGTTTIDFVSTIKRFPEE----NSHQKVIGGYWIRGGKASNNCTVLANLGVKVEFLGML--- 74
            ||..|:..|||:|...|.|:.    :.|:..||    .|||.:|.|...|..|.:...:..|   
  Fly     6 VLVFGSAIIDFISYTTRLPKAGETLHGHRFQIG----YGGKGANQCVAAARQGSRTALVAKLGAD 66

  Fly    75 -------------------------SSWSVFQVLVDDLKSRGIII-----DNCPTCDQGAPFSSV 109
                                     .:..|.|:.|.|.....|||     :...:||..   |:.
  Fly    67 TFGSDYLRHLREERVNVNHVEQLAEETTGVAQIAVSDGGENNIIIVVGANNRLSSCDVS---SAK 128

  Fly   110 ILTKATKTRNIVYCNNNFP----YVSIDDFRKLNLNQYGWIHIRALYFDKSLPMVKDIEAYNANR 170
            .|.:..|   ::.|....|    ..::..||.:::     ::......|....:::....:..|.
  Fly   129 ALFQEAK---VLVCQLETPVEATLTALRAFRGVSI-----VNAAPAMADTPPELLQLASIFCVNE 185

  Fly   171 KEKIVLSMEFD-NNLDDMWPLMDYCDYAVFSKKLAQPNGWVSLEDACMQLDERLRMRWGLNLKRP 234
            .|..:::...| .|::                         ..|||..:|     :..|.|.   
  Fly   186 SEAALMTQMPDIGNIE-------------------------HAEDAVGKL-----IAAGANT--- 217

  Fly   235 YVVVLWGDQGA--GILDLNGNFTHVKPHK--PKRIVDALGAGDTFVGAFIYALYIR-----ERSV 290
             |::..|..||  |..|..|...||....  |:::||..||||.|:||..:.|...     |..:
  Fly   218 -VIITLGKLGAVFGSADSKGVCQHVAAPSVPPEKVVDTTGAGDAFIGALAHNLARHPTRKLEEHI 281

  Fly   291 SVAVDFGNRMASYKCTKNGYDH 312
            :.|....::......|::.:.|
  Fly   282 AAACAVASQSVQLPGTQSSFPH 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7551NP_648466.1 Ketohexokinase 16..311 CDD:238914 70/344 (20%)
CG13369NP_569850.1 ribokinase 6..303 CDD:238579 70/345 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456467
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.