DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7551 and SPCC338.14

DIOPT Version :9

Sequence 1:NP_648466.1 Gene:CG7551 / 39280 FlyBaseID:FBgn0036161 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_588154.1 Gene:SPCC338.14 / 2539129 PomBaseID:SPCC338.14 Length:340 Species:Schizosaccharomyces pombe


Alignment Length:306 Identity:75/306 - (24%)
Similarity:128/306 - (41%) Gaps:67/306 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GGKASNNC-----TVLANLGVKVEFLGMLSSWSVFQVLVDDLKSRGI----IIDNCPTCDQGAPF 106
            ||.|.|:|     .:..|..|   |.|.:.......:|::..:..|:    .:|  ||...|.  
pombe    56 GGAAQNSCRAAQYVLPPNSTV---FAGCVGQDKFADMLLESNEKAGLRSEFSVD--PTTPTGV-- 113

  Fly   107 SSVILTKATKTRNIVYCN-----NNFPYVSIDDFRKLNLNQYGW--------IHIRALYFDKSLP 158
            .:|:|:...|.|::  |.     ||:   .:.|.::.|:    |        |::...:...|..
pombe   114 CAVVLSNNNKNRSL--CTNLGAANNY---KLKDLQQPNV----WKFVEEAKVIYVGGFHLTVSPE 169

  Fly   159 MVKDIEAY-NANRKEKIV------LSMEFDNNLDDMWPLMDYCDYAVFSK----KLAQPNGWVS- 211
            .:..:..: |.|.|..|:      ||..|...:|.:.|   ||||.:.::    ...:.:|..| 
pombe   170 SMLCLAQHANENNKPYIMNLSAPFLSQFFKEQMDSVIP---YCDYVIGNEAEILSYGENHGIKST 231

  Fly   212 -LEDACMQLDERLRMRWGLNLKRPYVVVLWGDQGAGILDLNGNFTHVKPHK--PKRIVDALGAGD 273
             :::..:.|....:    :|.||..|||:.....|.|:..:|..|..||::  .:.|||..||||
pombe   232 DVQEIALALSSVEK----VNKKRTRVVVITQGADATIVAKDGKVTTYKPNRVPSEEIVDTNGAGD 292

  Fly   274 TFVGAFIYALYIRERSVSVAVDFGNRMASYKCTKNGYDHIANILLP 319
            .|.|.||.|| .:.:.:..||..|:.:.. :|.|     ::...||
pombe   293 AFAGGFIAAL-SQGQGIDYAVTLGHWLGQ-ECIK-----VSGTTLP 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7551NP_648466.1 Ketohexokinase 16..311 CDD:238914 73/296 (25%)
SPCC338.14NP_588154.1 PTZ00247 1..331 CDD:240328 73/304 (24%)
ribokinase_pfkB_like 11..337 CDD:294126 75/306 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.