DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7551 and Adk

DIOPT Version :9

Sequence 1:NP_648466.1 Gene:CG7551 / 39280 FlyBaseID:FBgn0036161 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_598840.1 Gene:Adk / 11534 MGIID:87930 Length:361 Species:Mus musculus


Alignment Length:332 Identity:69/332 - (20%)
Similarity:119/332 - (35%) Gaps:95/332 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTQYGHKLSWAVGKKTVLCIGTTTID-FVSTIKR----------FPEENSHQKVIGGYWIRGGKA 54
            :.|..||.:...|     |||   || |...:||          :.|:|..........|.||  
Mouse    92 LIQEPHKAATFFG-----CIG---IDKFGEILKRKAADAHVDAHYYEQNEQPTGTCAACITGG-- 146

  Fly    55 SNNCTVLANLGV-----KVEFLGMLSSWSVFQVLVDDLKSRGIIIDNCPTCDQGAPFSSVILTKA 114
              |.:::|||..     |.:.|.:..:|    |||:  |:|                        
Mouse   147 --NRSLVANLAAANCYKKEKHLDLERNW----VLVE--KAR------------------------ 179

  Fly   115 TKTRNIVYCNNNFPYVSIDDFRKLNLNQYGWIHIRALYFDKSLPMVKDIEAYNANRKEKIVLSME 179
                  ||....| ::::.....|.:.:|...:.|....:.|.|.:                |..
Mouse   180 ------VYYIAGF-FLTVSPESVLKVARYAAENNRVFTLNLSAPFI----------------SQF 221

  Fly   180 FDNNLDDMWPLMDY-----CDYAVFSKKLAQPNGWVSLEDACMQLDERLRMRWGLNLKRPYVVVL 239
            |...|.|:.|.:|.     .:.|.|    |:..|:.:.:  ..::.::.:....:|.||...|:.
Mouse   222 FKEALMDVMPYVDILFGNETEAATF----AREQGFETKD--IKEIAKKAQALPKVNSKRQRTVIF 280

  Fly   240 WGDQGAGILDLNGNFT--HVKPHKPKRIVDALGAGDTFVGAFIYALYIRERSVSVAVDFGNRMAS 302
            ...:...|:....:.|  .|.....:.|:|..||||.|||.|:..| :.::.::..:..|:..||
Mouse   281 TQGRDDTIVAAENDVTAFPVLDQNQEEIIDTNGAGDAFVGGFLSQL-VSDKPLTECIRAGHYAAS 344

  Fly   303 YKCTKNG 309
            ....:.|
Mouse   345 VIIRRTG 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7551NP_648466.1 Ketohexokinase 16..311 CDD:238914 65/317 (21%)
AdkNP_598840.1 Nuclear localization signal. /evidence=ECO:0000250 7..15
ribokinase_pfkB_like 28..360 CDD:320807 69/332 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.