DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7557 and CG4880

DIOPT Version :9

Sequence 1:NP_648464.1 Gene:CG7557 / 39278 FlyBaseID:FBgn0036159 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_573177.1 Gene:CG4880 / 32680 FlyBaseID:FBgn0030803 Length:351 Species:Drosophila melanogaster


Alignment Length:339 Identity:98/339 - (28%)
Similarity:158/339 - (46%) Gaps:63/339 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RRTSCQRYRERLRSNRLSQLLHGLSI----------------VATVTLGVVLMFFLGMKLSTEQM 91
            |||..:|.:...|.|: ....|.|.|                :..:..|:.::.....||||.. 
  Fly    28 RRTEIRRLQSNRRLNK-KVCKHHLDIAHCTQKKAPWRNWAYLILALAAGIGMLLQFTDKLSTVS- 90

  Fly    92 DYPAPREEGLWLGFLRLLGLEQEDYLSGDLYVHNKDTFCSPEALNLERIFRYMGRVVLNQEQALS 156
                        |||...   :..|.|   .|||:|.:|:| :..|..:..:....||||:.||:
  Fly    91 ------------GFLESY---KNQYHS---IVHNQDNYCNP-SRRLGDMVLHARHQVLNQDLALN 136

  Fly   157 RMERALSGSGRFRSVALLGPPGVGKTLATETLRRCFPWPRNAHSYSWSTQVSDEASKFRLIRQFA 221
            ::|.||..:.. .::.|:|..||||:.....||..||||.|.::.||:     .:|....::...
  Fly   137 QLELALDNTTN-EAIVLVGTSGVGKSHTARILRETFPWPENVNTLSWT-----GSSSLGRVKSML 195

  Fly   222 DGLSECGVNLLIIDNLTTCDHGLVPIYNRLILEREGEPKGN-------QRVLVVYVFNLETNLYW 279
            .||:.||.|:::|||:|..|...|||.|.:|  .|||...|       :|:.:|::||:.:....
  Fly   196 SGLTYCGQNMILIDNMTPKDAHFVPIINEMI--SEGEKSANHTEHPQQKRLTIVFIFNVNSMQPG 258

  Fly   280 EQF----ELLQELPAETTIVNFRFFNEDDLLDCLASELKRERRILTSKKESFILQEAMKTV--HS 338
            |:|    |:|:.:| .|.:|.|...:...|:||    ::||..|.....|...::|.:|::  .:
  Fly   259 EEFEMDMEILRNMP-HTQLVTFATLDPTHLVDC----IRREAAIAMVHLEDEHVEEIIKSIDASA 318

  Fly   339 SGCKSLRLLLLQNG 352
            |||||:...:|..|
  Fly   319 SGCKSILAKVLLYG 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7557NP_648464.1 AAA 151..268 CDD:99707 42/123 (34%)
CG4880NP_573177.1 AAA 131..>181 CDD:99707 19/50 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444972
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9VS
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0020065
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.