DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6149 and YHR140W

DIOPT Version :9

Sequence 1:NP_648463.2 Gene:CG6149 / 39277 FlyBaseID:FBgn0036158 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_012009.1 Gene:YHR140W / 856543 SGDID:S000001182 Length:239 Species:Saccharomyces cerevisiae


Alignment Length:160 Identity:30/160 - (18%)
Similarity:61/160 - (38%) Gaps:41/160 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RKLRDYIFATFAVPLALT----VGLTFW--TLFAID---------REVIYPVLLDLVYPNWLNHT 131
            :|..|:|.....:|::|.    |...:|  .||.::         .:..:|:.:|:        .
Yeast    79 KKKSDFISRHVTLPVSLVLESIVATVYWPLRLFFVNLIMHGVESTAKTPFPMTVDM--------A 135

  Fly   132 MHTFVVIYAFVELGITRHQYPKRSRGF-----------TGLGAFMLGYLVWIHIVWFRTDIWVYP 185
            :|.:.::|...:     |........|           |.|......||.:: |...:...:.||
Yeast   136 IHLYPILYLLAD-----HYLSGSGTKFKLSNKHAWLIVTSLAFSYFQYLAFL-IDAGQGQAYPYP 194

  Fly   186 FLGGIAWQLRVIFFVLIMVLGFIYYLFGER 215
            || .:....:.|.||::..:.:.||:|.::
Yeast   195 FL-DVNEPYKSIIFVVVATITWAYYVFYQK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6149NP_648463.2 Far-17a_AIG1 10..218 CDD:282588 30/160 (19%)
YHR140WNP_012009.1 Far-17a_AIG1 <83..220 CDD:368096 28/151 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3989
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10989
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.