DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6149 and Aig1

DIOPT Version :9

Sequence 1:NP_648463.2 Gene:CG6149 / 39277 FlyBaseID:FBgn0036158 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_079722.1 Gene:Aig1 / 66253 MGIID:1913503 Length:262 Species:Mus musculus


Alignment Length:225 Identity:81/225 - (36%)
Similarity:118/225 - (52%) Gaps:22/225 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LSATVHLGYAIYFDCRYAQLPQVAVTLRLEPPIGGKFKYMTFLCGLLQLGYYTLALTFDLLRL-- 78
            |...:.|.|.... |.|.     |:.:......||.:|::||:..::|..::.:.:..||..|  
Mouse     9 LRVAILLSYCSIL-CNYK-----AIEMPSHQTYGGSWKFLTFIDLVIQAVFFGICVLTDLSSLLT 67

  Fly    79 ---------RSLRK---LRDYIFATFAVPLALTVGLTFWTLFAIDREVIYPVLLDLVYPNWLNHT 131
                     |.|||   |||:..|..|.|:.:.|...|||::|.|||:|||.|||...|.||||.
Mouse    68 RGSGNQEQERQLRKLISLRDWTLAVLAFPVGVFVVAVFWTIYAYDREMIYPRLLDNFIPGWLNHG 132

  Fly   132 MHTFVVIYAFVELGITRHQYPKRSRGFTGLGAFMLGYLVWIHIVWFRTDIWVYPFLGGIAWQLRV 196
            |||.|:.:..:|:..:.||||.||.|...:..|.:||::|:..:...|.:||||||..|....|:
Mouse   133 MHTTVLPFILIEMRTSHHQYPSRSSGLAAICTFSVGYILWVCWIHHVTGMWVYPFLEHIGSGARI 197

  Fly   197 IFFVLIMVLGFIYYLFGERVNNVLW--QRS 224
            |||....:|....||.||.:|:.:|  ||:
Mouse   198 IFFGSTTILMNFLYLLGEVLNSYIWDTQRT 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6149NP_648463.2 Far-17a_AIG1 10..218 CDD:282588 77/215 (36%)
Aig1NP_079722.1 Far-17a_AIG1 12..219 CDD:368096 76/212 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847208
Domainoid 1 1.000 166 1.000 Domainoid score I3859
eggNOG 1 0.900 - - E1_KOG3989
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I4084
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49430
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 1 1.000 - - otm42705
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10989
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X992
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.