DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6149 and aig1

DIOPT Version :9

Sequence 1:NP_648463.2 Gene:CG6149 / 39277 FlyBaseID:FBgn0036158 Length:234 Species:Drosophila melanogaster
Sequence 2:XP_009293152.1 Gene:aig1 / 562261 ZFINID:ZDB-GENE-041014-358 Length:290 Species:Danio rerio


Alignment Length:214 Identity:80/214 - (37%)
Similarity:116/214 - (54%) Gaps:21/214 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 YFD--CRYAQLPQVAVTLRLEPPIGGKFKYMTFLCGLLQLGYYTLALTFDLLRL----------- 78
            ||.  |.|.     |:.:......||.:|::||:..::|..::.:.:..||..|           
Zfish    70 YFSILCNYK-----AIDMPAHQTYGGSWKFLTFIDLVIQAVFFGVCVLTDLSSLLTKGSASMEQE 129

  Fly    79 RSLRK---LRDYIFATFAVPLALTVGLTFWTLFAIDREVIYPVLLDLVYPNWLNHTMHTFVVIYA 140
            |.|||   |||::.|..|.|:.:.|...||||:..||::|||.|||...|.||||.|||.|:.:.
Zfish   130 RQLRKLIGLRDWMMAVLAFPVGVFVVTMFWTLYLYDRDLIYPRLLDNFIPQWLNHGMHTTVLPFI 194

  Fly   141 FVELGITRHQYPKRSRGFTGLGAFMLGYLVWIHIVWFRTDIWVYPFLGGIAWQLRVIFFVLIMVL 205
            .:|:..|.|:||.|..|...:.||.:||:||:..|...|.:||||.|..|....|::||..:|.|
Zfish   195 IIEMRTTHHRYPSRPCGLLAVCAFAVGYVVWMCWVHSMTGVWVYPLLEHIGPTARILFFFCLMAL 259

  Fly   206 GFIYYLFGERVNNVLWQRS 224
            ..:||:.||.:||.:|..|
Zfish   260 INVYYVLGEILNNYIWDSS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6149NP_648463.2 Far-17a_AIG1 10..218 CDD:282588 76/206 (37%)
aig1XP_009293152.1 Far-17a_AIG1 65..272 CDD:282588 76/206 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592443
Domainoid 1 1.000 159 1.000 Domainoid score I4045
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 164 1.000 Inparanoid score I4176
OMA 1 1.010 - - QHG49430
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 1 1.000 - - mtm6435
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10989
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X992
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1212.010

Return to query results.
Submit another query.