DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6149 and C37E2.10

DIOPT Version :9

Sequence 1:NP_648463.2 Gene:CG6149 / 39277 FlyBaseID:FBgn0036158 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001355467.1 Gene:C37E2.10 / 39010802 WormBaseID:WBGene00304175 Length:223 Species:Caenorhabditis elegans


Alignment Length:121 Identity:32/121 - (26%)
Similarity:49/121 - (40%) Gaps:4/121 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RKLRDYIFATFAVPLALTVGLTFWTLFAIDREVIYPVLLDLVYPNWLNHTMHTFVVIYAFVELGI 146
            ||..|::..|...|:|....:.||.||..||.::.|.....|:...|.|...|:.::||.::...
 Worm    62 RKFVDFLHFTVMFPVAAISFVLFWALFVFDRTLVIPQAKLHVFRWLLCHFHDTYPLLYALLDSYF 126

  Fly   147 TRHQYPKRSRGFTGLGAFMLGYLVWIHIVWFRTDIWVYPFLGGIAWQLRVIFFVLI 202
            .:.:.|....|.......:..|.:....|.|.....:||    |...|.|..|.||
 Worm   127 HKRKVPDHLAGLVISATLVFIYFMTARCVKFVDSGRIYP----IFQTLSVPQFALI 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6149NP_648463.2 Far-17a_AIG1 10..218 CDD:282588 32/121 (26%)
C37E2.10NP_001355467.1 Far-17a_AIG1 <40..194 CDD:309749 32/121 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I5037
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I3702
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 1 1.000 - - mtm4768
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10989
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X992
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.