DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6149 and Adtrp

DIOPT Version :9

Sequence 1:NP_648463.2 Gene:CG6149 / 39277 FlyBaseID:FBgn0036158 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001014166.1 Gene:Adtrp / 361228 RGDID:1305679 Length:230 Species:Rattus norvegicus


Alignment Length:182 Identity:65/182 - (35%)
Similarity:99/182 - (54%) Gaps:11/182 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GGKFKYMTFLCGLLQLGYYTLALTFDLLR-------LRSLRKLRDYIFATFAVPLALTVGLTFWT 106
            ||:.||:|.|..|||..::.:|...|:|:       ::.:...||.:|.|.|.||:..|.|.||:
  Rat    40 GGRSKYLTLLNLLLQAVFFGVACLDDVLKRVIGRKDIKFITYFRDLLFTTLAFPLSTFVFLVFWS 104

  Fly   107 LFAIDREVIYPVLLDLVYPNWLNHTMHTFVVIYAFVELGITRHQYPKRSRGFTGLGAFMLGYLVW 171
            ||..||.::||..||..:|.|:||.|||.:..::..|..:..|.||.:..|.:.|||....|:  
  Rat   105 LFHYDRSLVYPKGLDDFFPAWVNHAMHTSIFPFSLAETVLRPHNYPSKKLGLSLLGACNFAYI-- 167

  Fly   172 IHIVW--FRTDIWVYPFLGGIAWQLRVIFFVLIMVLGFIYYLFGERVNNVLW 221
            |.|:|  .:|..||||....::....::||....:|....|||||::|:..|
  Rat   168 IRILWRYVQTGNWVYPVFASLSPLGIILFFSASYILSASLYLFGEKINHWKW 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6149NP_648463.2 Far-17a_AIG1 10..218 CDD:282588 63/177 (36%)
AdtrpNP_001014166.1 Far-17a_AIG1 5..216 CDD:368096 63/177 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350717
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3989
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49430
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10989
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X992
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.820

Return to query results.
Submit another query.