DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6149 and CG11601

DIOPT Version :9

Sequence 1:NP_648463.2 Gene:CG6149 / 39277 FlyBaseID:FBgn0036158 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_001285545.1 Gene:CG11601 / 33197 FlyBaseID:FBgn0031244 Length:275 Species:Drosophila melanogaster


Alignment Length:239 Identity:94/239 - (39%)
Similarity:131/239 - (54%) Gaps:22/239 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLNLSNRA---------RLFFHLSATVHLGYAIYFDCRYAQLPQVAVTL---RLEPPIGGKFKYM 55
            :||..|.|         |...||.|.....|.|||  .|.::......|   .|:...||||||:
  Fly    24 QLNTCNDAYTSGAFKYLRFLVHLLAAAQFSYGIYF--HYFRVHWPTDLLDEDELKARWGGKFKYL 86

  Fly    56 TFLCGLLQLGYYTLALTFDLL--------RLRSLRKLRDYIFATFAVPLALTVGLTFWTLFAIDR 112
            |||..:||..|::|||..||.        ....||.:|||:||.||.|:|..|.|:||.::..||
  Fly    87 TFLDVILQAIYHSLALLNDLFGDNNVSGDSKSMLRSVRDYVFAAFAFPVAHNVCLSFWVIYVWDR 151

  Fly   113 EVIYPVLLDLVYPNWLNHTMHTFVVIYAFVELGITRHQYPKRSRGFTGLGAFMLGYLVWIHIVWF 177
            |:|:|..||.::|:||||.:||.|.:.|.::|.....:||.|..|.||..:|:|.|::|:|||.:
  Fly   152 ELIFPSALDAIFPSWLNHVVHTNVALLAIMDLFTCFRRYPSRLAGITGNVSFILLYIIWLHIVRY 216

  Fly   178 RTDIWVYPFLGGIAWQLRVIFFVLIMVLGFIYYLFGERVNNVLW 221
            .:..||||.|..:...||.:|..|::....:.||.||..|||:|
  Fly   217 FSGEWVYPILEVLPAYLRYVFLALLVGFNLVCYLLGEFANNVVW 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6149NP_648463.2 Far-17a_AIG1 10..218 CDD:282588 87/227 (38%)
CG11601NP_001285545.1 Far-17a_AIG1 40..257 CDD:282588 86/218 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469169
Domainoid 1 1.000 159 1.000 Domainoid score I4045
eggNOG 1 0.900 - - E1_KOG3989
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 164 1.000 Inparanoid score I4176
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 1 1.000 - - mtm6435
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10989
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X992
109.900

Return to query results.
Submit another query.