DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6149 and SPBPJ4664.05

DIOPT Version :9

Sequence 1:NP_648463.2 Gene:CG6149 / 39277 FlyBaseID:FBgn0036158 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_595280.2 Gene:SPBPJ4664.05 / 2541381 PomBaseID:SPBPJ4664.05 Length:223 Species:Schizosaccharomyces pombe


Alignment Length:171 Identity:35/171 - (20%)
Similarity:73/171 - (42%) Gaps:16/171 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GGKFKYMTFLCGLLQLGYYTLALTFDLLRLRSLRKLRDYIFATFAVPLALTVGLTFWTLFAIDRE 113
            |..|:::|.|...:.|....:.|..|:....:|.||:: |......||...|.:.:|::.:.||.
pombe    43 GSHFQHLTVLSLAVTLLSMVVGLFSDISGSLTLVKLKN-ILLYIVCPLETIVSILYWSIVSYDRS 106

  Fly   114 VIYPVLLDLVYPNWLNHTMHTFVVIYAFVELGITRHQYPKRSRGFT-GLGAFML-------GYLV 170
            ::.|....:..|...:.::|....:|..::       |...|..|: .:|..:|       .|::
pombe   107 LLIPKDRPVPLPLNFDISVHLMPTVYTLID-------YLFFSPPFSLSIGPSLLVYLSIAVSYML 164

  Fly   171 WIHIVWFRTDIWVYPFLGGIAWQLRVIFFVLIMVLGFIYYL 211
            |:...:.....:.||.|..:....:.||:.:..::.|..|:
pombe   165 WVEKCYQMNKFYAYPILAILDPIKKTIFYTVASIISFSCYI 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6149NP_648463.2 Far-17a_AIG1 10..218 CDD:282588 35/171 (20%)
SPBPJ4664.05NP_595280.2 Far-17a_AIG1 12..211 CDD:282588 35/171 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 56 1.000 Domainoid score I3146
eggNOG 1 0.900 - - E1_KOG3989
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2024
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10989
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.