DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6149 and C37E2.3

DIOPT Version :9

Sequence 1:NP_648463.2 Gene:CG6149 / 39277 FlyBaseID:FBgn0036158 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_510364.2 Gene:C37E2.3 / 183293 WormBaseID:WBGene00007995 Length:216 Species:Caenorhabditis elegans


Alignment Length:203 Identity:48/203 - (23%)
Similarity:100/203 - (49%) Gaps:10/203 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LSNRARLFFHLSATVHLGYAIYFDCRYAQLPQVAVTLRLEPPIGGKFKYMTFLCGLLQLGYYTLA 70
            :|..:.|.|.:...|.|. |:.||  :.|.|::..:..:.     |...:|.|..:|.:.|.||.
 Worm     1 MSKGSFLLFPVLCVVWLA-ALCFD--FLQQPRLNHSWYIY-----KLILLTNLAFVLNVVYSTLV 57

  Fly    71 LTFDLLRLRSLRKLRDYIFATFAVPLALTVGLTFWTLFAIDREVIYPVLLDLVYPNWLNHTMHTF 135
            :..  .:.::::::.|::..|...|:|:.:...||..:..|.:::.|..:..:.|:||||..||:
 Worm    58 VIG--YKSKTIKEVVDFMHFTAMFPVAVILCGMFWGFYVYDSDLVMPAWVAEIVPSWLNHINHTY 120

  Fly   136 VVIYAFVELGITRHQYPKRSRGFTGLGAFMLGYLVWIHIVWFRTDIWVYPFLGGIAWQLRVIFFV 200
            ::::..::....:...|..|..:.....::..|.:.:..|.:...:||||.|...:..|.||.::
 Worm   121 LIVFILLDSYYHKRDAPSNSTSWMISVVYVTFYFIIVLGVKYYNRMWVYPVLQSFSIDLFVISYI 185

  Fly   201 LIMVLGFI 208
            |.:|:.||
 Worm   186 LSVVIFFI 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6149NP_648463.2 Far-17a_AIG1 10..218 CDD:282588 47/199 (24%)
C37E2.3NP_510364.2 Far-17a_AIG1 5..203 CDD:309749 47/199 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I5037
eggNOG 1 0.900 - - E1_KOG3989
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I3702
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49430
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 1 1.000 - - mtm4768
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10989
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X992
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.