DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6149 and Adtrp

DIOPT Version :9

Sequence 1:NP_648463.2 Gene:CG6149 / 39277 FlyBaseID:FBgn0036158 Length:234 Species:Drosophila melanogaster
Sequence 2:NP_780626.1 Gene:Adtrp / 109254 MGIID:1924596 Length:262 Species:Mus musculus


Alignment Length:236 Identity:83/236 - (35%)
Similarity:124/236 - (52%) Gaps:21/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ERLNLSNRARLFFHLSAT-----VHLGYAIYFDCRYAQLPQVAVTLRLEPPIGGKFKYMTFLCGL 61
            ||:.||.|:|.....:.|     :.|.:.|:.:....|:.:....|| |...||:.||:|.|..|
Mouse    21 ERVPLSLRSREAMTKTTTCVYHFLVLNWYIFLNYHIPQIGRNEEKLR-EFHDGGRSKYLTLLNLL 84

  Fly    62 LQLGYYTLALTFDLLR-------LRSLRKLRDYIFATFAVPLALTVGLTFWTLFAIDREVIYPVL 119
            ||..::.:|...|:|:       ::.:...||.:|.|.|.|::..|.|.|||||..||.::||..
Mouse    85 LQAIFFGVACLDDVLKRVIGRKDIKFVTSFRDLLFTTMAFPISTFVFLVFWTLFHYDRSLVYPKG 149

  Fly   120 LDLVYPNWLNHTMHTFVVIYAFVELGITRHQYPKRSRGFTGLGAFMLGYLVWIHIVW--FRTDIW 182
            ||..:|.|:||.|||.:..::..|..:..|.||.:..|.|.||||...|:  |.|:|  .:|..|
Mouse   150 LDDFFPAWVNHAMHTSIFPFSLFETILRPHNYPSKKLGLTLLGAFNFAYI--IRILWRYVQTGNW 212

  Fly   183 VYPFLGGIAWQLRVIFF--VLIMVLGFIYYLFGERVNNVLW 221
            |||....::....:|||  ..|:|.|.  |||||::|:..|
Mouse   213 VYPVFDSLSPLGIIIFFSAAYILVAGI--YLFGEKINHWKW 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6149NP_648463.2 Far-17a_AIG1 10..218 CDD:282588 76/223 (34%)
AdtrpNP_780626.1 Far-17a_AIG1 37..248 CDD:282588 75/215 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847205
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3989
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49430
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10989
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X992
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.820

Return to query results.
Submit another query.