DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6149 and adtrp

DIOPT Version :9

Sequence 1:NP_648463.2 Gene:CG6149 / 39277 FlyBaseID:FBgn0036158 Length:234 Species:Drosophila melanogaster
Sequence 2:XP_004915357.1 Gene:adtrp / 101734886 XenbaseID:XB-GENE-982158 Length:229 Species:Xenopus tropicalis


Alignment Length:180 Identity:65/180 - (36%)
Similarity:99/180 - (55%) Gaps:7/180 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GGKFKYMTFLCGLLQLGYYTLALTFDLLR-------LRSLRKLRDYIFATFAVPLALTVGLTFWT 106
            ||.:||:|.|..:||.|:|.:....|||.       :..:...||.:|:..|.|.:..|.|.||.
 Frog    40 GGLWKYLTILNVVLQTGFYAICFVADLLMSVPGVKLVNYIVSCRDLVFSVLAFPASTFVFLAFWA 104

  Fly   107 LFAIDREVIYPVLLDLVYPNWLNHTMHTFVVIYAFVELGITRHQYPKRSRGFTGLGAFMLGYLVW 171
            |::.||:::||..||.:.|.||||.:||.|...|.:|:..:.|:||.:.:|...||...:.||.|
 Frog   105 LYSYDRQLVYPDGLDKIIPLWLNHAVHTAVFPLAVLEMVTSPHRYPPKKKGLLLLGLCSVCYLSW 169

  Fly   172 IHIVWFRTDIWVYPFLGGIAWQLRVIFFVLIMVLGFIYYLFGERVNNVLW 221
            :..::|....|||||||.::....::|.....||....|:.||..|::||
 Frog   170 VLWIYFADGKWVYPFLGLLSPFEFIMFSFSSNVLAGSVYIAGEAFNHLLW 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6149NP_648463.2 Far-17a_AIG1 10..218 CDD:282588 62/175 (35%)
adtrpXP_004915357.1 Far-17a_AIG1 7..216 CDD:368096 62/175 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 150 1.000 Domainoid score I4344
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4247
OMA 1 1.010 - - QHG49430
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 1 1.000 - - mtm9416
Panther 1 1.100 - - O PTHR10989
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X992
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.