DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6149 and LOC100495442

DIOPT Version :9

Sequence 1:NP_648463.2 Gene:CG6149 / 39277 FlyBaseID:FBgn0036158 Length:234 Species:Drosophila melanogaster
Sequence 2:XP_002942833.3 Gene:LOC100495442 / 100495442 -ID:- Length:232 Species:Xenopus tropicalis


Alignment Length:187 Identity:68/187 - (36%)
Similarity:102/187 - (54%) Gaps:19/187 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GGKFKYMTFLCGLLQLGYYTLALTFDLL--------RLRS-LRKLRDYIFATFAVPLALTVGLTF 104
            ||::||:||:..:||..::.:.:..||.        :|.| |.:|||..||..|.|:.:.|..:|
 Frog    38 GGRWKYLTFINQVLQTVFFAICVLSDLAPLVLPKKKKLSSFLLQLRDGTFAVLAFPIGVFVVASF 102

  Fly   105 WTLFAIDREVIYPVLLDLVYPNWLNHTMHTFVVIYAFVELGITRHQYPKRSRGFTGLGAFMLGYL 169
            |.::|.|||::||.:||.:.|.||||.|||.|:....|||....|:||.|..|.:.:.||.|.|:
 Frog   103 WGIYAYDRELVYPKVLDSIIPQWLNHCMHTVVLPLLLVELYACSHRYPSRKWGISIMAAFSLLYM 167

  Fly   170 VWIHIVWFRTDIWVYPFLG-----GIAWQLRVIFFVLIMVLGFIYYLFGERVNNVLW 221
            .|:..:...:.|||||.|.     |:|     :||...|::...:|..||.:....|
 Frog   168 AWVLWIHHASGIWVYPLLAKLDAVGLA-----VFFAGAMLVTVPFYCLGELLTWFRW 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6149NP_648463.2 Far-17a_AIG1 10..218 CDD:282588 67/182 (37%)
LOC100495442XP_002942833.3 Far-17a_AIG1 35..214 CDD:368096 67/180 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 150 1.000 Domainoid score I4344
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4247
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482757at2759
OrthoFinder 1 1.000 - - FOG0001424
OrthoInspector 1 1.000 - - mtm9416
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X992
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.