DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11726 and TIF3

DIOPT Version :9

Sequence 1:NP_648461.1 Gene:CG11726 / 39275 FlyBaseID:FBgn0036156 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_015489.1 Gene:TIF3 / 856292 SGDID:S000006367 Length:436 Species:Saccharomyces cerevisiae


Alignment Length:284 Identity:64/284 - (22%)
Similarity:107/284 - (37%) Gaps:74/284 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SQVDNAELFMYGDGPKKSNSDLQKKVSTPDPEEEVSMEPPFVALVSNLPMECT-EGELRKVFTSF 108
            |::|.|    .|.|    :||.:::...||       .||:.|:::|:|.:.| ||....|....
Yeast    76 SRLDPA----LGGG----SSDRREEYPVPD-------APPYRAVINNIPWDITPEGVQAWVEDGL 125

  Fly   109 ----SIRSLTIPKKGKRP---KGFAYVEMDSREDLVRLLKMDKLKCRGRCLMAKIGQLPPEPPTK 166
                ::..:.:||..:.|   ||.|:|.:..|.|||.:||.:..|...|.:...:.     .|.:
Yeast   126 VKPEAVEEVVLPKNLRDPTRLKGNAFVTLKERADLVAVLKFNGTKLNERTVYVSVA-----APRR 185

  Fly   167 AAGDGFSLFTCSGRQF---------DIN-----SSHYSASVSDLSTIDSP-ISARNSPFPSESE- 215
            ..|......:..|..|         |::     .|::.....:...:|.. .:||.|.|...|. 
Yeast   186 GGGADVDWSSARGSNFQGDGREDAPDLDWGAARGSNFRGPRREREEVDIDWTAARGSNFQGSSRP 250

  Fly   216 -----------------SSFFGRDNPIKRIPSSTEEVERRMQIRLQKLAEFENSESERIKSECED 263
                             |:|.|...|.:|     |..|..:.....:.:.|::  |.|......:
Yeast   251 PRREREEVDIDWSAARGSNFQGSSRPPRR-----EREEPDIDWSAARGSNFQS--SSRPPRRERE 308

  Fly   264 DPDAFMSWSDALDEIRKSETDSSN 287
            :||  :.||.|    |.|...||:
Yeast   309 EPD--IDWSAA----RGSNFQSSS 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11726NP_648461.1 RRM_SF 84..156 CDD:302621 23/79 (29%)
TIF3NP_015489.1 RRM4_RBM12_like 102..179 CDD:409936 22/76 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.