DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11726 and NOP12

DIOPT Version :9

Sequence 1:NP_648461.1 Gene:CG11726 / 39275 FlyBaseID:FBgn0036156 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_014601.1 Gene:NOP12 / 854116 SGDID:S000005401 Length:459 Species:Saccharomyces cerevisiae


Alignment Length:286 Identity:61/286 - (21%)
Similarity:102/286 - (35%) Gaps:98/286 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SSSVSSVSGSESGQGLEDMLHVTKVRTSQVDNAELFMYGDGP-----KKS-------NSDLQKKV 70
            ||::.::.|:...:.:|          |.||  :||....||     .||       :|..:::.
Yeast     2 SSAIDNLFGNIDEKKIE----------SSVD--KLFSSSCGPINKLEVKSKTRTVLPDSKKRERA 54

  Fly    71 STPDPEEEVSMEPPFVALVSNLPMECTEGELRKVFTSFSIRSLTIPKKGKRPKGFAYVEMDSRED 135
            :..|.||:.:.:|.    ||:...|  |..|.||            ||.|:.|     ..|..||
Yeast    55 AEADQEEKEASKPD----VSDEQTE--EVALPKV------------KKAKKSK-----RNDEDED 96

  Fly   136 L-----VRLLKMDKLKCRGRCLMAKIGQLPPEPPTKAAGDGFSL-FTCSGRQFDINSSHYSASV- 193
            |     .:||..:             .:...:.||....|..|: .|.:.::.|........:. 
Yeast    97 LEARYYAKLLNEE-------------AEAEDDKPTVTKTDETSVPLTSAAKKVDFKEDELEKAER 148

  Fly   194 -----SDLSTIDSPISARNSPFPSESESSFFGRDNPIKRIPSSTEEVERRMQIRLQKLAEFENS- 252
                 :.|||:   |:::.   ..:.....|| .|||.....|..|.|.      :...:.:|: 
Yeast   149 TVFIGNILSTV---ITSKK---VYKEFKKLFG-TNPIAETEESGNEKEE------ESSKKSDNNE 200

  Fly   253 ---ESERIKSECEDDPDAFMSWSDAL 275
               ||.|.:|         :|:.:||
Yeast   201 FAIESIRFRS---------ISFDEAL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11726NP_648461.1 RRM_SF 84..156 CDD:302621 17/76 (22%)
NOP12NP_014601.1 RRM1_Nop12p_like 148..272 CDD:410070 20/92 (22%)
RRM2_Nop12p_like 280..370 CDD:410071
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.