DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11726 and NUC-L1

DIOPT Version :9

Sequence 1:NP_648461.1 Gene:CG11726 / 39275 FlyBaseID:FBgn0036156 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_175322.1 Gene:NUC-L1 / 841314 AraportID:AT1G48920 Length:557 Species:Arabidopsis thaliana


Alignment Length:232 Identity:50/232 - (21%)
Similarity:81/232 - (34%) Gaps:55/232 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KMSKSSRSFKLPPVSSSSVSSVSGSESGQGLEDMLHVTKVRTSQVDNAELFMYGDGPKKSNSDLQ 67
            |.::.....|....|||..||.|..:..:..|:.                      |||.:||::
plant   231 KPAQKKADTKASKKSSSDESSESEEDESEDEEET----------------------PKKKSSDVE 273

  Fly    68 ---------KKVSTPDPEEEVSMEPPFVALVS-NLPMECTEGELRKVFTSFSIRSLTIPKKGKRP 122
                     |:..||........:..|.|.:| |:.....|...::......:|..|....|.. 
plant   274 MVDAEKSSAKQPKTPSTPAAGGSKTLFAANLSFNIERADVENFFKEAGEVVDVRFSTNRDDGSF- 337

  Fly   123 KGFAYVEMDSREDLVRLLKMDKLKCRGRCLMAKI-------GQLPPEPPT----KAAGDG----- 171
            :||.:||..|.|:..:.|:.......||.:...|       |:.|...|.    ::.|||     
plant   338 RGFGHVEFASSEEAQKALEFHGRPLLGREIRLDIAQERGERGERPAFTPQSGNFRSGGDGGDEKK 402

  Fly   172 --FSLFTCSGRQFDINSS---HYSASVSDLSTIDSPI 203
              ...|..|..:.||.::   |:| |..::..:..||
plant   403 IFVKGFDASLSEDDIKNTLREHFS-SCGEIKNVSVPI 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11726NP_648461.1 RRM_SF 84..156 CDD:302621 17/72 (24%)
NUC-L1NP_175322.1 RRM1_NUCLs 298..375 CDD:240896 18/77 (23%)
RRM2_NUCLs 402..479 CDD:240897 9/38 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.