DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11726 and PHIP1

DIOPT Version :9

Sequence 1:NP_648461.1 Gene:CG11726 / 39275 FlyBaseID:FBgn0036156 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_191094.1 Gene:PHIP1 / 824700 AraportID:AT3G55340 Length:597 Species:Arabidopsis thaliana


Alignment Length:258 Identity:59/258 - (22%)
Similarity:94/258 - (36%) Gaps:71/258 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 KVSTPD-PEEEVS--MEPPFV-----ALVSNLPMECTEGELRKVFTSFSIRSLTIPKKGKRP--K 123
            |.:||. |..:.|  ..|..|     ..:.||..:.||.::||:|:...|.|:.:.|..:..  |
plant   238 KTTTPSIPRRKTSSGFAPEMVDGYNRVYIGNLAWDTTERDIRKLFSDCVINSVRLGKNKETGEFK 302

  Fly   124 GFAYVEMDSREDLVRLLKMDKLKCRGR----CLMAKIGQLPPEPP--TKAAGDGFSLFTCSGRQF 182
            |:|:|:......:...||:|:....||    |...|........|  |..||             
plant   303 GYAHVDFKDSVSVAIALKLDQQVICGRPVKICCALKDRPATDHTPGETNNAG------------- 354

  Fly   183 DINSSHYSASVSDLSTIDSPISARNSPFPSESE---SSFFGRDNPIKRIPSSTEEVERRM----- 239
                   |.::.|......|:.|    ....||   .::|.       ...|:.:|:||:     
plant   355 -------SYNMEDTYAAADPVPA----LAGRSEVDDGNYFA-------TTVSSSKVKRRVCYECG 401

  Fly   240 ---------QIRLQKLAEFENSESERIKSECEDDPDAFMSW---SDALDEIRKSET-DSSNHT 289
                     .|:|||..:..||   ::..|..|...|..|:   .::.|....:|| .|:|.|
plant   402 EKGHLSTACPIKLQKADDQANS---KLGQETVDGRPAMQSYGLPKNSGDSYYMNETYASTNET 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11726NP_648461.1 RRM_SF 84..156 CDD:302621 21/82 (26%)
PHIP1NP_191094.1 RRM <129..327 CDD:223796 24/88 (27%)
RRM1_PHIP1 163..234 CDD:240717
RRM2_PHIP1 263..334 CDD:240718 19/70 (27%)
PTZ00368 393..592 CDD:173561 18/72 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.