powered by:
Protein Alignment CG11726 and Cirbp
DIOPT Version :9
Sequence 1: | NP_648461.1 |
Gene: | CG11726 / 39275 |
FlyBaseID: | FBgn0036156 |
Length: | 291 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006241075.3 |
Gene: | Cirbp / 81825 |
RGDID: | 620756 |
Length: | 176 |
Species: | Rattus norvegicus |
Alignment Length: | 50 |
Identity: | 13/50 - (26%) |
Similarity: | 26/50 - (52%) |
Gaps: | 3/50 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 89 VSNLPMECTEGELRKVFTSF-SIRSLTIPK--KGKRPKGFAYVEMDSRED 135
|..|..:..|..|.:||:.: .|..:.:.| :.:|.:||.:|..::.:|
Rat 10 VGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDD 59
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.