DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11726 and Eif4b

DIOPT Version :9

Sequence 1:NP_648461.1 Gene:CG11726 / 39275 FlyBaseID:FBgn0036156 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_663600.2 Gene:Eif4b / 75705 MGIID:95304 Length:611 Species:Mus musculus


Alignment Length:416 Identity:67/416 - (16%)
Similarity:113/416 - (27%) Gaps:193/416 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FKLPPVSSSSVSSVSGSESGQGLEDMLHVTKVRTSQVDNAELFMYGDGPKKSNSDLQKKVSTPDP 75
            ::.||:..|.:.:...:              .|...:|.:.|      ||               
Mouse    63 YRAPPIDRSILPTAPRA--------------AREPNIDRSRL------PK--------------- 92

  Fly    76 EEEVSMEPPFVALVSNLPMECTEGELRKVFTSFSIRSLTIPKKGKRP---KGFAYVEMDSREDLV 137
                  .||:.|.:.|||.:.||..::..|...:|.::.:|::...|   |||.|.|.:..:.|:
Mouse    93 ------SPPYTAFLGNLPYDVTEDSIKDFFRGLNISAVRLPREPSNPDRLKGFGYAEFEDLDSLL 151

  Fly   138 RLLKMDKLKCRGRCLMAKIG--------------------------------------QLPPEPP 164
            ..|.:::.....|.:...:.                                      ..||...
Mouse   152 SALSLNEESLGNRRIRVDVADQAQDKDRDDRSFGRDRNRDSDKTDTDWRARPTTDSFDDYPPRRG 216

  Fly   165 TKAAGD----------------------------------------------GFSLFTCSGR--- 180
            ..:.||                                              |:.....|||   
Mouse   217 DDSFGDKYRDRYDSDRYRDGYRDGYRDGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRAF 281

  Fly   181 -------------------QFDINSSHYSASVSDLSTIDSPISARNSP-----------FPSESE 215
                               ::|.......:|..|.|..|.....|..|           .|.|.:
Mouse   282 GSGYRRDDDYRGGGDRYEDRYDRRDDRSWSSRDDYSRDDYRRDDRGPPQRPRLNLKPRSAPKEDD 346

  Fly   216 -----------SSFFGRDNPIKRIPSSTEEVERRMQIRLQKLAEFENSESERIKSECEDDP---- 265
                       :|.||...|:     .|...||.::.||||       |.|:::.:. |:|    
Mouse   347 ASASTSQSSRAASIFGGAKPV-----DTAAREREVEERLQK-------EQEKLQRQL-DEPKLDR 398

  Fly   266 ---DAFMSW-SDALDEIRKSETDSSN 287
               :...|| |:...|..:|.|.|.:
Mouse   399 RPRERHPSWRSEETQERERSRTGSES 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11726NP_648461.1 RRM_SF 84..156 CDD:302621 19/74 (26%)
Eif4bNP_663600.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..93 8/70 (11%)
RRM <83..256 CDD:223796 28/199 (14%)
RRM_eIF4B 95..171 CDD:240848 19/75 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..611 39/265 (15%)
DUF1777 225..>290 CDD:285811 4/64 (6%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530583at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.