DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11726 and EIF4H

DIOPT Version :9

Sequence 1:NP_648461.1 Gene:CG11726 / 39275 FlyBaseID:FBgn0036156 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_071496.1 Gene:EIF4H / 7458 HGNCID:12741 Length:248 Species:Homo sapiens


Alignment Length:192 Identity:50/192 - (26%)
Similarity:78/192 - (40%) Gaps:25/192 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 EEEVSMEPPFVALVSNLPMECTEGELRKVFTSFSIRSLTI--PKKGKRPKGFAYVEMDSREDLVR 138
            ::|:..|||:.|.|.|||....:|::..:|...||||:.:  .|...:.|||.|||.|..:.|..
Human    33 QKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKE 97

  Fly   139 LLKMDKLKCRGRCLMAKIGQLPPEPPTKAAGDGFSLFTCSGRQFDINSSHYSA----SVSDLST- 198
            .|..|......|.|...|.:     ..|....||...........:.||..|.    |..|.:: 
Human    98 ALTYDGALLGDRSLRVDIAE-----GRKQDKGGFGFRKGGPDDRGMGSSRESRGGWDSRDDFNSG 157

  Fly   199 -IDSPISARNSPFPSESES-----SFFGRDNPIK------RIPSSTEEVER-RMQIRLQKLA 247
             .|..:..|....|.:..:     |.|....|::      |.|:..|..:| |:|::.:.:|
Human   158 FRDDFLGGRGGSRPGDRRTGPPMGSRFRDGPPLRGSNMDFREPTEEERAQRPRLQLKPRTVA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11726NP_648461.1 RRM_SF 84..156 CDD:302621 25/73 (34%)
EIF4HNP_071496.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 2/7 (29%)
RRM_eIF4H 37..120 CDD:409835 28/87 (32%)
SF-CC1 <40..>227 CDD:273721 48/185 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..248 20/99 (20%)
HHV-1 Vhs binding site 137..157 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530583at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.880

Return to query results.
Submit another query.