DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11726 and eif4ba

DIOPT Version :9

Sequence 1:NP_648461.1 Gene:CG11726 / 39275 FlyBaseID:FBgn0036156 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001092707.2 Gene:eif4ba / 553214 ZFINID:ZDB-GENE-060629-1 Length:616 Species:Danio rerio


Alignment Length:211 Identity:50/211 - (23%)
Similarity:73/211 - (34%) Gaps:69/211 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 PPFVALVSNLPMECTEGELRKVFTSFSIRSLTIPKKGKRP---KGFAYVEMDSREDLVRLLKMDK 144
            ||:.|.:.|||.:.||..::..|...||.::.:|::...|   |||.|.|.|..|.|::.|.:::
Zfish    94 PPYTAFLGNLPYDVTEDSIKNFFRGLSISAVRLPREPSNPERLKGFGYAEFDDVESLLQALSLNE 158

  Fly   145 LKCRGRCLMAKIGQLPPEPPTKAAGDGFSLFTCSGRQFDINSSHYSASVSDLSTIDSPISARNSP 209
            .....|.:...|.....|   |...|.    :.|||  |.|.|.     .|:.            
Zfish   159 ENLGNRRIRVDIADQSNE---KERDDR----SVSGR--DRNRSD-----RDMG------------ 197

  Fly   210 FPSESESSFFGRDNPIKRIPSSTEEVERRMQIRLQKLAEFENSESERIKSECEDDPDAFMSWSDA 274
             |.:::|.:..|.                                   |||.:|.|..    .||
Zfish   198 -PDKTDSDWRARP-----------------------------------KSEADDGPRR----DDA 222

  Fly   275 LDEIRKSETDSSNHTE 290
            ..|..|...||..|.|
Zfish   223 FAERSKDRYDSDRHRE 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11726NP_648461.1 RRM_SF 84..156 CDD:302621 22/74 (30%)
eif4baNP_001092707.2 RRM <91..235 CDD:223796 48/206 (23%)
RRM_eIF4B 95..171 CDD:240848 22/75 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530583at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.