DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11726 and eif4b

DIOPT Version :9

Sequence 1:NP_648461.1 Gene:CG11726 / 39275 FlyBaseID:FBgn0036156 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_012812217.1 Gene:eif4b / 448618 XenbaseID:XB-GENE-988676 Length:614 Species:Xenopus tropicalis


Alignment Length:285 Identity:62/285 - (21%)
Similarity:96/285 - (33%) Gaps:80/285 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SKSSRSFKLPPVSSSSVSSVSGSESGQGLEDMLHVTKVRTSQVDNAELFMYGDGPKKSNSDLQKK 69
            |....:::.||:..|.:.:...:              .|...||.:.|      ||         
 Frog    71 SNDDDAYRAPPIDRSILPTAPRA--------------AREPNVDRSRL------PK--------- 106

  Fly    70 VSTPDPEEEVSMEPPFVALVSNLPMECTEGELRKVFTSFSIRSLTIPKKGKRP---KGFAYVEMD 131
                        .|||.|.:.|||.:.||..::|.|...:|.::.:|::...|   |||.|.|.|
 Frog   107 ------------SPPFTAFLGNLPYDVTEESIQKFFRGLNISAVRLPREPSNPERLKGFGYAEFD 159

  Fly   132 SREDLVRLLKMDKLKCRGRCLMAKIGQLPPEPPTKAAGDGFSLFTCSGRQFDINSSHYSASVSDL 196
            ..:.|:|.|.:::.....|.:...|.....:...    |..|.    ||..|.|........||.
 Frog   160 DLDSLLRALSLNEESLGNRRIRVDIADQAQDKDR----DERSF----GRDRDRNRESDKTDSSDW 216

  Fly   197 STIDSPISARNSPFPSESESSFFGRDNPIKRIPSSTEEVERRMQIRLQKLAEFENSESERIKSEC 261
                     |..|    |..||  .|.|.:|...|..:..|.           :..||:|.:...
 Frog   217 ---------RARP----STDSF--DDYPPRRGDDSQGDRYRS-----------DRYESDRYRDGP 255

  Fly   262 EDDPDAFM--SWSDALDEIRKSETD 284
            ..|.|.:.  ...|..|:..:|:.|
 Frog   256 RRDGDRYERDRGRDRYDDRNRSDYD 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11726NP_648461.1 RRM_SF 84..156 CDD:302621 23/74 (31%)
eif4bXP_012812217.1 RRM_eIF4B 109..185 CDD:240848 23/75 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530583at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.