DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11726 and rbm34

DIOPT Version :9

Sequence 1:NP_648461.1 Gene:CG11726 / 39275 FlyBaseID:FBgn0036156 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001002382.1 Gene:rbm34 / 436655 ZFINID:ZDB-GENE-040718-77 Length:411 Species:Danio rerio


Alignment Length:147 Identity:33/147 - (22%)
Similarity:55/147 - (37%) Gaps:33/147 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 VSNLPMECTEGELRKVFTSF----SIRSLTIPKKGKRPKGFAYVEMDSREDLVRLLKMD-----K 144
            |.|||.:.:|..|:..|...    ::| |...:.....|||.||..:|.:.::..||::     :
Zfish   256 VGNLPYDISELPLQNHFQECGNIEAVR-LVRDRDSGMGKGFGYVLFESPDSVMLALKLNGSTLQQ 319

  Fly   145 LKCRGRCLMAKIGQLPPEPPTKAAGD-----------------GFSLFTCSGRQFDINSSHYSAS 192
            .|.|.:..:.|..:....|..||.|.                 |...||.:.|.....:|.:...
Zfish   320 RKIRVKRSVKKEKEKKTPPGRKAEGQRTGGGLKGPKQEFRNNTGRKNFTKNPRNKPTQASSFKGE 384

  Fly   193 VSDLSTIDSPISARNSP 209
            ::|      |.:.|..|
Zfish   385 MAD------PTAKRGKP 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11726NP_648461.1 RRM_SF 84..156 CDD:302621 19/75 (25%)
rbm34NP_001002382.1 RRM1_RBM34 149..240 CDD:240840
RRM2_RBM34 253..325 CDD:240841 19/69 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.