DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11726 and eIF4H2

DIOPT Version :9

Sequence 1:NP_648461.1 Gene:CG11726 / 39275 FlyBaseID:FBgn0036156 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001263122.1 Gene:eIF4H2 / 43645 FlyBaseID:FBgn0039797 Length:459 Species:Drosophila melanogaster


Alignment Length:106 Identity:31/106 - (29%)
Similarity:52/106 - (49%) Gaps:16/106 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DNAELFMYGDGPKKSN-SDLQKKVSTPDPEEEVSMEPPFVALVSNLPMECTEGELRKVFTSFSIR 111
            ||.|        .:|| .:.:.:....|.:.:|..||||:|.|.|||....:|::.|:|:.|.::
  Fly    33 DNRE--------NRSNFQNYRNRDRDRDRQRQVPTEPPFIAYVGNLPKGLVQGDVMKIFSDFEVK 89

  Fly   112 SLTIPKKGKRP--KGFAYVEMDSREDLVRLLKMDKLKCRGR 150
            ::.:.|..:..  ||:.|||.::...|     ...|.|.||
  Fly    90 NVRLIKDRETDEFKGYGYVEFETLAQL-----KSALNCNGR 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11726NP_648461.1 RRM_SF 84..156 CDD:302621 22/69 (32%)
eIF4H2NP_001263122.1 RRM <58..247 CDD:223796 24/73 (33%)
RRM_SF 62..140 CDD:302621 22/69 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530583at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.