DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11726 and eif4h

DIOPT Version :9

Sequence 1:NP_648461.1 Gene:CG11726 / 39275 FlyBaseID:FBgn0036156 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001184257.1 Gene:eif4h / 402996 ZFINID:ZDB-GENE-010328-19 Length:262 Species:Danio rerio


Alignment Length:231 Identity:56/231 - (24%)
Similarity:86/231 - (37%) Gaps:50/231 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GDGPKKSNSDLQKKVSTPDPEEEVSMEPPFVALVSNLPMECTEGELRKVFTSFSIRSLTI--PKK 118
            |.||:.....     |.|..::|:..|||:.|.|.|||....:|::..:|...|:||:.:  .|:
Zfish    20 GRGPRGGGGP-----SGPRKQKELPTEPPYTAYVGNLPFNTVQGDIDAIFRDLSVRSVRLVRDKE 79

  Fly   119 GKRPKGFAYVEMDSREDLVRLLKMDKLKCRGRCLMAKIGQLPPEPPTKAAGDGFSL--------- 174
            ..:.|||.|||.|..|.|...|..|......|.|...|.:...:   :..|.||..         
Zfish    80 TDKFKGFCYVEFDDLESLKEALTYDGALLGDRSLRVDIAEGRRQ---ERGGGGFGFRKDDRGRGG 141

  Fly   175 ---FTCSGR----QFDINSSHYSASVSDLSTIDSPI---SARNSPFPSESESSFFG--------- 220
               ....||    .||.:.   ..:..::...|...   .:|....|.:......|         
Zfish   142 SRGARGGGRDSREDFDQSG---GGAAGEMGFRDDDFMGGRSRGGGRPGDRRGGAGGGGGGGGGMG 203

  Fly   221 --RDNPIK------RIPSSTEEVER-RMQIRLQKLA 247
              ||.|.:      |.||..|..:| |:|::.:.:|
Zfish   204 RFRDGPPRGGQTDFREPSDEERAQRPRLQLKPRTVA 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11726NP_648461.1 RRM_SF 84..156 CDD:302621 25/73 (34%)
eif4hNP_001184257.1 RRM <39..>118 CDD:223796 27/78 (35%)
RRM_eIF4H 43..118 CDD:240847 25/74 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530583at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.