DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11726 and CG3594

DIOPT Version :9

Sequence 1:NP_648461.1 Gene:CG11726 / 39275 FlyBaseID:FBgn0036156 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster


Alignment Length:155 Identity:37/155 - (23%)
Similarity:65/155 - (41%) Gaps:32/155 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SKSSRSFKLPPVSSSSVSSVSGSESGQGLEDMLHVTKVRTSQVDNAELFMYGDGPKKSNSDLQKK 69
            |||....|....:::..|:.||:|..:..|:         .|:.:.:|.....|..|:|.     
  Fly    63 SKSEDEAKSDDEAAAEGSAASGAEEEESAEN---------GQITSDQLSSLLRGASKTNR----- 113

  Fly    70 VSTPDPEEEVSMEPPFVALVSNLPMECTEGELRKVFTSF-SIRSLTIPKKGKRPKGFAYVEMDSR 133
                           .|..|:||..|.|:.:|...|::. :::|:.|||  ||..|||:|||...
  Fly   114 ---------------HVLYVTNLNFETTKDDLELHFSAAGTVKSIRIPK--KRRGGFAFVEMADL 161

  Fly   134 EDLVRLLKMDKLKCRGRCLMAKIGQ 158
            .......::...:.:||.:..:|.:
  Fly   162 SSFQNAFQLHNTELQGRNIKVQISE 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11726NP_648461.1 RRM_SF 84..156 CDD:302621 22/72 (31%)
CG3594NP_523855.1 RRM3_Prp24 114..184 CDD:240744 22/71 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.