DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11726 and CG12288

DIOPT Version :9

Sequence 1:NP_648461.1 Gene:CG11726 / 39275 FlyBaseID:FBgn0036156 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster


Alignment Length:219 Identity:46/219 - (21%)
Similarity:78/219 - (35%) Gaps:54/219 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AKMSKSSRSFKLPPVSSSSVSSVSGSESGQGLEDMLHVTKVRTSQVDNAELFMYGDGPKKSNSDL 66
            |::...|::.|...|.....::.:....|:       |:|...:..:|.:    .:|.|:..   
  Fly    98 AQVKVESKATKKEKVEKEPTTAPNEKPKGK-------VSKKAKANANNKD----EEGVKRIR--- 148

  Fly    67 QKKVSTPDPEEEVSMEPPFVALVSNLPMECTEGELRKVFTSF----SIRSLT------IPKKGKR 121
                   :|.||.|     ...|.|||:.....:|.|:|..:    |||..|      ...|.::
  Fly   149 -------NPAEEAS-----TVFVGNLPINTKRVQLVKLFQPYGLVQSIRLRTAGGKQLFKHKQRK 201

  Fly   122 PKGF--AYVEMDSREDLVRLL-------KMDKLKCRGRCLMAKIGQLPPEPPTKAAGDGFSLFTC 177
            ..|.  |||.::..|...:.|       |.:.|:.....:..|.||...:.|:...         
  Fly   202 VAGSLNAYVVLEKPEIAQQALALNGSEFKENHLRVTPASMAEKFGQAKDKQPSDKD--------- 257

  Fly   178 SGRQFDINSSHYSASVSDLSTIDS 201
            :.|...:.|..|||:...|..|.|
  Fly   258 AKRTIFVGSLKYSATEEQLREIFS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11726NP_648461.1 RRM_SF 84..156 CDD:302621 20/90 (22%)
CG12288NP_609822.1 RRM1_RBM34 155..237 CDD:240840 21/86 (24%)
RRM_SF 261..332 CDD:302621 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.