DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11726 and eif4bb

DIOPT Version :9

Sequence 1:NP_648461.1 Gene:CG11726 / 39275 FlyBaseID:FBgn0036156 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_005166071.1 Gene:eif4bb / 336619 ZFINID:ZDB-GENE-030131-8563 Length:632 Species:Danio rerio


Alignment Length:298 Identity:67/298 - (22%)
Similarity:99/298 - (33%) Gaps:85/298 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ESGQGLEDMLHVTKVRTSQVDNAELFMYGDGPKKSNSDLQKKVST-------------------- 72
            |:|.........||. ||..|..:             ||:..|||                    
Zfish    24 ETGGNAPPSFPTTKA-TSWADETD-------------DLEGDVSTSWHTVEDTYRAPPIDRSILP 74

  Fly    73 --PDPEEEVSME-------PPFVALVSNLPMECTEGELRKVFTSFSIRSLTIPKKGKRP---KGF 125
              |....|.:::       ||:.|.:.|||.:.:|..:|..|...:|.::.:|::...|   |||
Zfish    75 TAPRAAREPNVDRSRLPRSPPYTAFLGNLPYDVSEESIRDFFRGLAISAVRLPREPNNPERLKGF 139

  Fly   126 AYVEMDSREDLVRLLKMDKLKCRGRCLMAKIGQLPPEPPTKAAGDGFSLFTCSGRQFDINSSHYS 190
            .|.|.|..|.|:|.|.:::.....|.:...|..   :...|....|.    .|||..|.:.....
Zfish   140 GYAEFDDIESLLRALSLNEENLGNRRIRVDIAD---QSNDKERDSGM----MSGRDRDRDRGRGM 197

  Fly   191 ASVSDLSTIDSPISARNSPFPSESESSFFGRDNPIKRIPSSTEEVERRMQIRLQKLAEFENSESE 255
            .|..|.:  ||...||    ||..:.     |.|.|......:..:|              .||:
Zfish   198 DSGPDKT--DSDWRAR----PSSDQD-----DGPRKDDGYGDKSRDR--------------YESD 237

  Fly   256 RIKSECEDDP---DAFMSWSDALDEIRKSETDSSNHTE 290
            |.:    |.|   |.|.......|..||...|..:..:
Zfish   238 RFR----DGPRRDDRFSGRDRYDDRDRKDRYDDRDRRD 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11726NP_648461.1 RRM_SF 84..156 CDD:302621 22/74 (30%)
eif4bbXP_005166071.1 RRM <91..246 CDD:223796 47/190 (25%)
RRM_eIF4B 95..171 CDD:240848 22/75 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530583at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.