DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11726 and Rbm34

DIOPT Version :9

Sequence 1:NP_648461.1 Gene:CG11726 / 39275 FlyBaseID:FBgn0036156 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001014037.1 Gene:Rbm34 / 307956 RGDID:1310161 Length:428 Species:Rattus norvegicus


Alignment Length:156 Identity:32/156 - (20%)
Similarity:62/156 - (39%) Gaps:38/156 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MSKSSRSFKLPPVSSSSVSSVSGSESGQGLEDMLHVTKVRTSQVDNAELFMYGDGPKKS------ 62
            :.:.:|..|:..:|.:. ..::..||.....|:   .::|..|         |.|.::|      
  Rat    97 LQEPARKVKVKKLSDAD-KRLANRESALANADL---EEIRQDQ---------GQGRRRSQSRGKV 148

  Fly    63 ------------NSDLQKKVSTP-DPEEEVSMEPPFVALVSNLPMECTEGELRKVFTSF----SI 110
                        |.|.:::...| :|||| .::......|.|||:.|.:.:|:..|..:    |:
  Rat   149 TDGEALDVALSLNEDGRQRTKVPLNPEEE-RLKNERTVFVGNLPVTCNKKKLKSFFKEYGQVESV 212

  Fly   111 RSLTI-PKKGKRPKGFAYVEMDSRED 135
            |..:: |.:|...|..|.::.....|
  Rat   213 RFRSVMPAEGTLSKKLAAIKRKFHPD 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11726NP_648461.1 RRM_SF 84..156 CDD:302621 14/57 (25%)
Rbm34NP_001014037.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..106 1/8 (13%)
RRM 73..364 CDD:223796 32/156 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..152 6/36 (17%)
RRM1_RBM34 183..274 CDD:240840 14/56 (25%)
RRM2_RBM34 286..358 CDD:240841
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..428
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23236
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.