Sequence 1: | NP_648461.1 | Gene: | CG11726 / 39275 | FlyBaseID: | FBgn0036156 | Length: | 291 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001006958.1 | Gene: | Eif4h / 288599 | RGDID: | 1359222 | Length: | 248 | Species: | Rattus norvegicus |
Alignment Length: | 205 | Identity: | 51/205 - (24%) |
---|---|---|---|
Similarity: | 68/205 - (33%) | Gaps: | 61/205 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 76 EEEVSMEPPFVALVSNLPMECTEGELRKVFTSFSIRSLTI--PKKGKRPKGFAYVEMDSREDLVR 138
Fly 139 LLKMDKLKCRGRCLMAKIGQLPPEPPTKAAGDGFSLFTCSGRQFDINSSHYSASVSDLSTIDSPI 203
Fly 204 SARNSP---------FPSESESSFFG--------------------RDNPIKR-----IPSSTEE 234
Fly 235 VERRMQIRLQ 244 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11726 | NP_648461.1 | RRM_SF | 84..156 | CDD:302621 | 25/73 (34%) |
Eif4h | NP_001006958.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..41 | 2/7 (29%) | |
RRM_eIF4H | 37..120 | CDD:409835 | 29/102 (28%) | ||
SF-CC1 | <40..>227 | CDD:273721 | 49/198 (25%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 121..248 | 20/97 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1530583at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
3 | 2.880 |