DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11726 and RBM34

DIOPT Version :10

Sequence 1:NP_648461.1 Gene:CG11726 / 39275 FlyBaseID:FBgn0036156 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_055829.2 Gene:RBM34 / 23029 HGNCID:28965 Length:430 Species:Homo sapiens


Alignment Length:145 Identity:33/145 - (22%)
Similarity:50/145 - (34%) Gaps:25/145 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PVSSSSVSSVSGSESGQGLEDMLHVTKVRTSQVDNAELFMYGDGPKKSNSDLQKKVS-------T 72
            |:|......|...:.....|..|...:...:..|..|......|.|:.||....||:       |
Human    97 PLSQEPAKKVKAKKKHTNAEKKLADRESALASADLEEEIHQKQGQKRKNSQPGVKVADRKILDDT 161

  Fly    73 PDP-----------EEEVSMEPPFVALVSNLPMECTEGELRKVFTSFS------IRSLTIPKKGK 120
            .|.           :||..::......|.|||:.|.:.:|:..|..:.      .||| ||.:|.
Human   162 EDTVVSQRKKIQINQEEERLKNERTVFVGNLPVTCNKKKLKSFFKEYGQIESVRFRSL-IPAEGT 225

  Fly   121 RPKGFAYVEMDSRED 135
            ..|..|.::.....|
Human   226 LSKKLAAIKRKIHPD 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11726NP_648461.1 RRM_SF 83..150 CDD:473069 16/59 (27%)
RBM34NP_055829.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..123 5/25 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..153 5/18 (28%)
RRM1_RBM34 185..276 CDD:409828 16/57 (28%)
RRM2_RBM34 288..360 CDD:409829
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..395
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 411..430
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.