DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11726 and RBM34

DIOPT Version :9

Sequence 1:NP_648461.1 Gene:CG11726 / 39275 FlyBaseID:FBgn0036156 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_055829.2 Gene:RBM34 / 23029 HGNCID:28965 Length:430 Species:Homo sapiens


Alignment Length:145 Identity:33/145 - (22%)
Similarity:50/145 - (34%) Gaps:25/145 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PVSSSSVSSVSGSESGQGLEDMLHVTKVRTSQVDNAELFMYGDGPKKSNSDLQKKVS-------T 72
            |:|......|...:.....|..|...:...:..|..|......|.|:.||....||:       |
Human    97 PLSQEPAKKVKAKKKHTNAEKKLADRESALASADLEEEIHQKQGQKRKNSQPGVKVADRKILDDT 161

  Fly    73 PDP-----------EEEVSMEPPFVALVSNLPMECTEGELRKVFTSFS------IRSLTIPKKGK 120
            .|.           :||..::......|.|||:.|.:.:|:..|..:.      .||| ||.:|.
Human   162 EDTVVSQRKKIQINQEEERLKNERTVFVGNLPVTCNKKKLKSFFKEYGQIESVRFRSL-IPAEGT 225

  Fly   121 RPKGFAYVEMDSRED 135
            ..|..|.::.....|
Human   226 LSKKLAAIKRKIHPD 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11726NP_648461.1 RRM_SF 84..156 CDD:302621 16/58 (28%)
RBM34NP_055829.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..123 5/25 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..153 5/18 (28%)
RRM 176..>382 CDD:223796 18/66 (27%)
RRM1_RBM34 185..276 CDD:240840 16/57 (28%)
RRM2_RBM34 288..360 CDD:240841
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..395
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 411..430
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.