DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11726 and Cirbp

DIOPT Version :10

Sequence 1:NP_648461.1 Gene:CG11726 / 39275 FlyBaseID:FBgn0036156 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001366350.1 Gene:Cirbp / 12696 MGIID:893588 Length:176 Species:Mus musculus


Alignment Length:50 Identity:13/50 - (26%)
Similarity:26/50 - (52%) Gaps:3/50 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 VSNLPMECTEGELRKVFTSF-SIRSLTIPK--KGKRPKGFAYVEMDSRED 135
            |..|..:..|..|.:||:.: .|..:.:.|  :.:|.:||.:|..::.:|
Mouse    10 VGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDD 59

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11726NP_648461.1 RRM_SF 83..150 CDD:473069 12/49 (24%)
CirbpNP_001366350.1 RRM_CIRBP_RBM3 6..85 CDD:409883 12/49 (24%)

Return to query results.
Submit another query.