DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11726 and Cirbp

DIOPT Version :9

Sequence 1:NP_648461.1 Gene:CG11726 / 39275 FlyBaseID:FBgn0036156 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001366350.1 Gene:Cirbp / 12696 MGIID:893588 Length:176 Species:Mus musculus


Alignment Length:50 Identity:13/50 - (26%)
Similarity:26/50 - (52%) Gaps:3/50 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 VSNLPMECTEGELRKVFTSF-SIRSLTIPK--KGKRPKGFAYVEMDSRED 135
            |..|..:..|..|.:||:.: .|..:.:.|  :.:|.:||.:|..::.:|
Mouse    10 VGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDD 59

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11726NP_648461.1 RRM_SF 84..156 CDD:302621 12/49 (24%)
CirbpNP_001366350.1 RRM_CIRBP_RBM3 6..85 CDD:409883 12/49 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.