DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6163 and Adf1

DIOPT Version :9

Sequence 1:NP_001261709.1 Gene:CG6163 / 39274 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001260730.1 Gene:Adf1 / 47082 FlyBaseID:FBgn0284249 Length:274 Species:Drosophila melanogaster


Alignment Length:125 Identity:31/125 - (24%)
Similarity:54/125 - (43%) Gaps:20/125 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 IIDAIKTRPSLWAGRQRSEKGQGQ-SRTSAVWKEAAMEMGLTPTLMQTRWSIIKQRYVDELQKER 290
            :|:|:|..|.::   .||...... .|.:..||:.|..:|:.......||..::.::..|::..:
  Fly    16 LIEAVKLNPVIY---DRSHYNYKHFVRKAQTWKQIAETLGVPEQKCTKRWKSLRDKFAREMKLCQ 77

  Fly   291 HAQYSHQSFRSTWEHFDRMSFM-------REILLKKVDEREQTREQIQEIVSEQQHHQQT 343
                     .|.|.:|.:|.|:       ||.||.|.....|:..|:.:...:||..|||
  Fly    78 ---------ESRWRYFKQMQFLVDSIRQYRESLLGKCANGSQSANQVADPSQQQQAQQQT 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6163NP_001261709.1 MADF 12..98 CDD:214738
MADF 226..316 CDD:214738 21/96 (22%)
Adf1NP_001260730.1 MADF 15..95 CDD:214738 19/90 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448364
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.