DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6163 and jigr1

DIOPT Version :9

Sequence 1:NP_001261709.1 Gene:CG6163 / 39274 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001097920.1 Gene:jigr1 / 43093 FlyBaseID:FBgn0039350 Length:336 Species:Drosophila melanogaster


Alignment Length:260 Identity:52/260 - (20%)
Similarity:93/260 - (35%) Gaps:69/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 LVPPPATVASETVATPPRKLGRPSSLHNSMRGR----IIDAIKTRPSLWAGRQRSEKG-QGQSRT 253
            |.||..          |:..|||.:.: :..|.    :|...::.|.|:   .||.|. :.:...
  Fly     7 LYPPQL----------PKGRGRPRATY-AQTGEFDLGLIREYRSHPVLY---DRSNKRFKDKLYV 57

  Fly   254 SAVWKEAAMEMGLTPTLMQTRWSIIKQRYVDELQKER-HAQYSHQSFRSTWEHFDRMSFM----- 312
            :.:|::.|.::|...|.::.|.:.::.||  .::|.| ....|.||  |.|..|:.:.|:     
  Fly    58 AHIWEQIAHKLGYDATSIRERMTTLRNRY--NIEKRRVENGLSTQS--SQWPLFESLQFLGDHIR 118

  Fly   313 --REILLKKVDEREQTREQIQEIVSEQQHHQQT---QHHPSQHLHHYRPPQP-------PAGLVE 365
              |......|.|.::...::.:..|:...|..:   :......:.......|       |....:
  Fly   119 PRRSFKNMSVKEEDEETYEVDDCRSDSNGHMNSIKDELEDDSEIFDCEQALPVTTVLGIPLNNSD 183

  Fly   366 HAQ--------DMPIGLVQHHHQEGHH------PTLAMHHP------------QH--SQPIRRRV 402
            .|.        :||.|...:|..|.:|      |...:..|            ||  ..|.:|||
  Fly   184 EANKSQRSTNGEMPNGKGYNHFAESYHRRHQNQPEYIISSPIVNPMRSNKRGSQHLDDHPSKRRV 248

  Fly   403  402
              Fly   249  248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6163NP_001261709.1 MADF 12..98 CDD:214738
MADF 226..316 CDD:214738 23/102 (23%)
jigr1NP_001097920.1 MADF 33..118 CDD:214738 22/91 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438484
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.