DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6163 and CG3919

DIOPT Version :9

Sequence 1:NP_001261709.1 Gene:CG6163 / 39274 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster


Alignment Length:369 Identity:63/369 - (17%)
Similarity:122/369 - (33%) Gaps:111/369 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PKEDPFVNRAQLLKAIKKYPEIWDSNNKLHMCRSVTSPMWTEIAEQFGGHVPTVKLQSIWSQMKY 66
            |..:.:...|::...:|.:|.::|.::..::.:|.....|.||:.:....|.:.|.:  |..::.
  Fly    10 PPPNVYAINAKICHLVKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKER--WRNIRS 72

  Fly    67 HYHNLVHRQILHKDRFNTKWEHFEPMSFMYNITVAKIVGAQSSGGSGGGTSSDAPSTATEAATVG 131
            .|...:.   ||... ||.:.:.|......:||                                
  Fly    73 SYARSIK---LHHGA-NTYYLNSELKFLQKHIT-------------------------------- 101

  Fly   132 EEPAAPVAPPPLPTATHG-RGRPSGSFSWLQTATTPTAPQLPHLITQPPHSQGHGMT-YTAFTGL 194
                     |.:|....| |.||.|                     |..|.:|...| ..|...:
  Fly   102 ---------PGVPVPLRGRRSRPKG---------------------QEEHDEGDPETPVEAILEM 136

  Fly   195 VPPPATVASETVAT-----PPRKLGRPSSLHNSMRGRIIDAIKTRPSLWAGRQRSEKGQGQSRTS 254
            |..|:.:.||...:     |.......::..|:....|:|...|.|:  ..|..|:..:.:::..
  Fly   137 VHSPSFLNSEHAQSRHSTDPASATDVEATQFNNEPSSIMDFEDTVPA--EMRTESDSSEKEAKVG 199

  Fly   255 AV--WKEAAMEMGLTPTLMQTRWSIIKQRYVDELQKERHAQYSHQSFRSTWEHFDRMSFMREILL 317
            .:  ::...:|...|.|           |.::.|..........|..|...:|   |:|.:::..
  Fly   200 EITLYRVPLLEFPKTST-----------RCIEALPIMDFDDAFLQGLRPEIKH---MNFHQKLYF 250

  Fly   318 KKVDEREQTREQIQEIVSEQQHHQQ--TQHHPSQHLHHYRPPQP 359
            |:         ::.:::.|..|.:|  :..||:|       |.|
  Fly   251 KR---------RVYDLLGEIFHSEQSASSTHPAQ-------PHP 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6163NP_001261709.1 MADF 12..98 CDD:214738 16/85 (19%)
MADF 226..316 CDD:214738 16/91 (18%)
CG3919NP_001261840.1 MADF 20..100 CDD:214738 16/85 (19%)
BESS 226..260 CDD:281011 6/45 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438516
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.