DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6163 and CG7745

DIOPT Version :9

Sequence 1:NP_001261709.1 Gene:CG6163 / 39274 FlyBaseID:FBgn0036155 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_610671.1 Gene:CG7745 / 36210 FlyBaseID:FBgn0033616 Length:506 Species:Drosophila melanogaster


Alignment Length:226 Identity:42/226 - (18%)
Similarity:87/226 - (38%) Gaps:60/226 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 MRGRIIDAIKTRPSLWAGRQR------SEKGQGQSRTSAVWKEAAMEMGLTPTLMQTRWSIIKQR 281
            |..::||.:.....:: .||:      :..|:.:::..| |:..||::.......:.||..:::|
  Fly     2 MDEQLIDEVAQHGVIY-NRQKYYLNGGANGGKYETKDEA-WQLIAMKLRTDVDTCKKRWKYLRER 64

  Fly   282 YVDELQKERHAQYSHQSFRSTWEHFDRMSFMREILLKKVDEREQTREQIQEIVSEQQHHQQTQHH 346
            ||.:.::.....|.|.|    ..:.::|.|:        |:..|.|:..             :|.
  Fly    65 YVSQRKQGDPPVYEHLS----RPYLEKMKFL--------DQHIQPRKSY-------------RHV 104

  Fly   347 PSQHLHHYRPPQP--PAGLVEHAQDMPIGLVQHHHQEGHHPTLAMHH---PQHS----------- 395
            |    :....||.  .:|..|:..|...|.:::..|.|......::|   .||:           
  Fly   105 P----NFLTSPQSANSSGYNEYQVDKSNGSMKNVSQFGSSGQSHLYHQPDQQHAMSALSNVAASA 165

  Fly   396 -QPIRRRVKHESDLEWDPF------EMILHV 419
             :.:..:||.|:|..:..|      :.:.|:
  Fly   166 LENVNGQVKIEADQVFRDFAAAVASQQLQHI 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6163NP_001261709.1 MADF 12..98 CDD:214738
MADF 226..316 CDD:214738 19/95 (20%)
CG7745NP_610671.1 MADF 5..96 CDD:214738 20/104 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448366
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.