Sequence 1: | NP_001261709.1 | Gene: | CG6163 / 39274 | FlyBaseID: | FBgn0036155 | Length: | 428 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_572838.2 | Gene: | CG4404 / 32241 | FlyBaseID: | FBgn0030432 | Length: | 308 | Species: | Drosophila melanogaster |
Alignment Length: | 260 | Identity: | 46/260 - (17%) |
---|---|---|---|
Similarity: | 75/260 - (28%) | Gaps: | 80/260 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KEDPFVNRAQLLKAIKKYPEIWDSNNKLHMCRSVTSPMWTEIAEQFGGHVPTVKLQSIWSQMKYH 67
Fly 68 YHNLVHRQILHKDRFNTKWEHFEPMSFMYNITVAKIVGAQ-------SSGGSGGGTSSDAPSTAT 125
Fly 126 EAATV--GEEP------------------AAPVAPPPL--------------------------- 143
Fly 144 ---PTATHG------------RGRPSGSFSWLQTATTPTAPQLPHLITQPPHSQGHGMTYTAFTG 193
Fly 194 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6163 | NP_001261709.1 | MADF | 12..98 | CDD:214738 | 9/85 (11%) |
MADF | 226..316 | CDD:214738 | |||
CG4404 | NP_572838.2 | MADF | 17..103 | CDD:214738 | 9/87 (10%) |
BESS | 267..301 | CDD:281011 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45438510 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |