DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6168 and Qpct

DIOPT Version :9

Sequence 1:NP_001287032.1 Gene:CG6168 / 39273 FlyBaseID:FBgn0036154 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_081731.1 Gene:Qpct / 70536 MGIID:1917786 Length:362 Species:Mus musculus


Alignment Length:319 Identity:123/319 - (38%)
Similarity:189/319 - (59%) Gaps:28/319 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YEPTELNLGQMRMIA-GLSDPENLRKNVQRIAIKRAVSTPGHSEVRNYIVDYLKKL--NWNVELD 102
            ::|..||...::.:| |.|..|..:.:::.:.|:|...:||....|.:|:..:::|  .|.||:|
Mouse    44 HQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVD 108

  Fly   103 IFTQKVPIMSNVTFHNIVARQNPQTQRYLMFGCHYDSKYFKDFD---FMAATDSAVPCALMLNMA 164
            .|..:.| ....:|.||::..||:.:|:|:..||||||||..:|   |:.|||||||||:||.:|
Mouse   109 TFLSRTP-YGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELA 172

  Fly   165 TILKHQFH--------RSQVSLMLVFFDGEEAFGEWSQEDSPYGSRHLAELWEKH---------G 212
            ..|..:.|        :..:||.|:||||||||..||.:||.|||||||:.....         .
Mouse   173 RALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTN 237

  Fly   213 FLDKIDLFVLPDLIGAKDVVFKKNILDTSGWFHRLVQLELKLFQAGIVRS---ERPLFK-FEPGI 273
            .||.:||.||.|||||.:..|......|:.||:||..:|.:|::.|:::.   ||..|: |..|.
Mouse   238 QLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGN 302

  Fly   274 DVDDDHLPFTRRNVPVIHLISNKYPAVWHQAEDVEMNVDYNTTEQVGLVLRMFVMEYLN 332
            .:.|||:||.|:.|||:|||::.:|.|||..:|.|.|:..:|.:.:..::::||:|||:
Mouse   303 IIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLH 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6168NP_001287032.1 M28_QC_like 49..330 CDD:193501 117/307 (38%)
QpctNP_081731.1 M28_QC_like 60..359 CDD:193501 116/299 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834723
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3946
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.861353 Normalized mean entropy S1680
OMA 1 1.010 - - QHG55920
OrthoDB 1 1.010 - - D1257754at2759
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 1 1.000 - - mtm8891
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1074
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.770

Return to query results.
Submit another query.