DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6168 and qpct

DIOPT Version :9

Sequence 1:NP_001287032.1 Gene:CG6168 / 39273 FlyBaseID:FBgn0036154 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001017245.1 Gene:qpct / 549999 XenbaseID:XB-GENE-953343 Length:359 Species:Xenopus tropicalis


Alignment Length:368 Identity:134/368 - (36%)
Similarity:192/368 - (52%) Gaps:62/368 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IALICLAIIVVVITICQSFHTNFLTVGRNGTLR---YEPTELNLGQMRMIAGLSD-PENLRKNVQ 68
            |||||.|..::.:.:   .|||..:|....|..   :.|..|:...::.:...:| .:..:.:::
 Frog    10 IALICGAFYLLSVCV---IHTNGQSVSSRWTTEKNSHRPVVLHTSDIQKVLSQTDVGQMFQTDLK 71

  Fly    69 RIAIKRAVSTPGHSEVRNYIVDYLKKL--NWNVELDIFTQKVPIMSNVTFHNIVARQNPQTQRYL 131
            .:..:|...:||:..||.:|...|:.|  .|..|.|.|....| ...|||.||::..||..:|:|
 Frog    72 PMLTERYAGSPGNYAVRQHIKQRLQSLQAGWVTEEDTFEAPTP-YGYVTFSNIISTLNPSAKRHL 135

  Fly   132 MFGCHYDSKYFK-DFD---FMAATDSAVPCALMLNMATILKHQFHRS-----QVSLMLVFFDGEE 187
            :..||||||||. .:|   |:.|.|:|||||:||.:|..|.....:.     .:||.|:||||||
 Frog   136 VLACHYDSKYFSPQWDGRVFVGAIDAAVPCAMMLELARALDSSLKKKLNSKLDLSLQLIFFDGEE 200

  Fly   188 AFGEWSQEDSPYGSRHLAELWEK-------------HGFLDKIDLFVLPDLIGAKDVVFKKNILD 239
            ||..||..||.|||:|||:..|.             ||    ||||:|.||||..:.||.....:
 Frog   201 AFQRWSSYDSLYGSKHLAQKMETISHPPNAENTNQLHG----IDLFILLDLIGTANPVFPNYFQN 261

  Fly   240 TSGWFHRLVQLELKL---------------FQAGIVRSERPLFKFEPGIDVDDDHLPFTRRNVPV 289
            |:.||:||..:|.:|               ||:|        |:..|   |.|||:||.:|.||:
 Frog   262 TARWFNRLQSIERRLHGLNLLKNHPSEVQYFQSG--------FRARP---VLDDHVPFLQRGVPI 315

  Fly   290 IHLISNKYPAVWHQAEDVEMNVDYNTTEQVGLVLRMFVMEYLN 332
            :|||.:.:|.|||..||.|.|:|..|.|.:..:|::||:||||
 Frog   316 LHLIPSPFPEVWHTMEDNEENLDSATIENLNKILQVFVLEYLN 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6168NP_001287032.1 M28_QC_like 49..330 CDD:193501 117/320 (37%)
qpctNP_001017245.1 M28_QC_like 51..356 CDD:349876 117/320 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55920
OrthoDB 1 1.010 - - D1257754at2759
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1074
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.