DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6168 and QPCTL

DIOPT Version :9

Sequence 1:NP_001287032.1 Gene:CG6168 / 39273 FlyBaseID:FBgn0036154 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_060129.2 Gene:QPCTL / 54814 HGNCID:25952 Length:382 Species:Homo sapiens


Alignment Length:361 Identity:138/361 - (38%)
Similarity:197/361 - (54%) Gaps:40/361 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPCWRSFIALICLAIIVVVITICQSFH--TNFLTVGRNGTLRYEPTELNL--------GQMRMIA 55
            :|..|....|:.||:.....||...:|  |..|.:||         ||.:        .::|.:.
Human    30 LPRVRLLPLLLALAVGSAFYTIWSGWHRRTEELPLGR---------ELRVPLIGSLPEARLRRVV 85

  Fly    56 GLSDPENLRKNVQR-IAIKRAVSTPGHSEVRNYIVDYLKKL--NWNVELDIFTQKVPIMSNVTFH 117
            |..||:.|.....| :.:.|...:||:.:||.::...|:.|  .|:||||.||...| :..|.|.
Human    86 GQLDPQRLWSTYLRPLLVVRTPGSPGNLQVRKFLEATLRSLTAGWHVELDPFTASTP-LGPVDFG 149

  Fly   118 NIVARQNPQTQRYLMFGCHYDSKYFK--DFDFMAATDSAVPCALMLNMATILKHQFHRSQ----- 175
            |:||..:|:..|:|...||||||.|.  ...|:.||||||||||:|.:|..|..:..|::     
Human   150 NVVATLDPRAARHLTLACHYDSKLFPPGSTPFVGATDSAVPCALLLELAQALDLELSRAKKQAAP 214

  Fly   176 VSLMLVFFDGEEAFGEWSQEDSPYGSRHLAELWEK--HG----FLDKIDLFVLPDLIGAKDVVFK 234
            |:|.|:|.|||||..||..:||.|||||||:|.|.  |.    .:..|:||:|.||:||.:..|.
Human   215 VTLQLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFMLLDLLGAPNPTFY 279

  Fly   235 KNILDTSGWFHRLVQLELKLFQAGIVRSE-RPLFKFEPGI---DVDDDHLPFTRRNVPVIHLISN 295
            .:...|..|||||..:|.:|.:..:::|. :.:..|:||.   .|:|||:||.||.|||:||||.
Human   280 SHFPRTVRWFHRLRSIEKRLHRLNLLQSHPQEVMYFQPGEPFGSVEDDHIPFLRRGVPVLHLIST 344

  Fly   296 KYPAVWHQAEDVEMNVDYNTTEQVGLVLRMFVMEYL 331
            .:|||||...|.|:|:...|...:..:|.:|:.|||
Human   345 PFPAVWHTPADTEVNLHPPTVHNLCRILAVFLAEYL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6168NP_001287032.1 M28_QC_like 49..330 CDD:193501 121/300 (40%)
QPCTLNP_060129.2 M28_QC_like 79..379 CDD:193501 121/300 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144604
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3946
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55920
OrthoDB 1 1.010 - - D1257754at2759
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 1 1.000 - - mtm8656
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1074
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.