DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6168 and isoQC

DIOPT Version :9

Sequence 1:NP_001287032.1 Gene:CG6168 / 39273 FlyBaseID:FBgn0036154 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_788550.1 Gene:isoQC / 40270 FlyBaseID:FBgn0036999 Length:354 Species:Drosophila melanogaster


Alignment Length:318 Identity:135/318 - (42%)
Similarity:192/318 - (60%) Gaps:35/318 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LRYEPTELNLGQMRMIAGLSDPENLRKNVQRIAIKRAVSTPGHSEVRNYIVDYLKKLNWNVELDI 103
            :.|.|:||:..:....:.|||..:||:.:.:|.|.|.|.|..||.||.|||..|:.|:|:||::.
  Fly    40 ISYNPSELSEPRFLEYSNLSDKLHLREAIDKILIPRVVGTTNHSIVREYIVQSLRDLDWDVEVNS 104

  Fly   104 FTQKVPIMSNVTFHNIVARQNPQTQRYLMFGCHYDSKYFKDFDFMAATDSAVPCALMLNMATILK 168
            |....||...:.||||:|..||..:|||:..|||||||....:|:.|||||||||::||:|.:|:
  Fly   105 FHDHAPIKGKLHFHNIIATLNPNAERYLVLSCHYDSKYMPGVEFLGATDSAVPCAMLLNLAQVLQ 169

  Fly   169 HQ---FHRSQVSLMLVFFDGEEAFGEWSQEDSPYGSRHLAELWEKHGFLDKIDLFVLPDLIGAKD 230
            .|   ..:|::||||:||||||||.||..:||.||:||||:.|...|.||:||:.||.||:||.|
  Fly   170 EQLKPLKKSKLSLMLLFFDGEEAFEEWGPKDSIYGARHLAKKWHHEGKLDRIDMLVLLDLLGAPD 234

  Fly   231 VVFKKNILDTSGWFHRLVQLELKL----------------------FQAGIVRSERPLFKFEPGI 273
            ..|.....:|..|:.|:..:|.:|                      ||:..:||.          
  Fly   235 PAFYSFFENTESWYMRIQSVETRLAKLQLLERYASSGVAQRDPTRYFQSQAMRSS---------- 289

  Fly   274 DVDDDHLPFTRRNVPVIHLISNKYPAVWHQAEDVEMNVDYNTTEQVGLVLRMFVMEYL 331
            .::|||:||.|||||::|||...:|:|||..:|....:||.||:.:.|::|:|.:|||
  Fly   290 FIEDDHIPFLRRNVPILHLIPVPFPSVWHTPDDNASVIDYATTDNLALIIRLFALEYL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6168NP_001287032.1 M28_QC_like 49..330 CDD:193501 128/305 (42%)
isoQCNP_788550.1 M28_QC_like 56..346 CDD:193501 128/299 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445048
Domainoid 1 1.000 42 1.000 Domainoid score I12432
eggNOG 1 0.900 - - E1_KOG3946
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 243 1.000 Inparanoid score I3283
Isobase 1 0.950 - 0.861353 Normalized mean entropy S1680
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D117458at50557
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 1 1.000 - - mtm8656
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1074
1110.850

Return to query results.
Submit another query.