DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6168 and Qpctl

DIOPT Version :9

Sequence 1:NP_001287032.1 Gene:CG6168 / 39273 FlyBaseID:FBgn0036154 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001099700.1 Gene:Qpctl / 292687 RGDID:1308128 Length:383 Species:Rattus norvegicus


Alignment Length:346 Identity:132/346 - (38%)
Similarity:194/346 - (56%) Gaps:24/346 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IALICLAIIVVVITICQSFHTNFLTVGRNGTLRYEPT--ELNLGQMRMIAGLSDPENLRKNVQR- 69
            :.|:.||:.:....:..|:|.....|.|:..||. |.  .|:..::|::.|..||:.|.....| 
  Rat    38 LLLLALALGLAFYIVWNSWHPGVEEVSRSRDLRV-PLIGSLSEAKLRLVVGQLDPQRLWGTFLRP 101

  Fly    70 IAIKRAVSTPGHSEVRNYIVDYLKKLN--WNVELDIFTQKVPIMSNVTFHNIVARQNPQTQRYLM 132
            :.|.|...:||:.:||.::...|:.|:  |:||||.||...| :..:.|.|:||..:|...|:|.
  Rat   102 LLIVRPPGSPGNLQVRKFLEATLQSLSAGWHVELDPFTASTP-LGPLDFGNVVATLDPGAARHLT 165

  Fly   133 FGCHYDSKYFKDF--DFMAATDSAVPCALMLNMATILKHQFHR-----SQVSLMLVFFDGEEAFG 190
            ..||||||:|...  .|:.||||||||||:|.:...|.....|     :.|:|.|:|.|||||..
  Rat   166 LACHYDSKFFPPGLPPFVGATDSAVPCALLLELVQALDVMLSRIKQQAAPVTLQLLFLDGEEALK 230

  Fly   191 EWSQEDSPYGSRHLAELWEK--HG----FLDKIDLFVLPDLIGAKDVVFKKNILDTSGWFHRLVQ 249
            ||..:||.|||||||::.|.  |.    .:..|:||||.||:||...:|..:...|:.||.||..
  Rat   231 EWGPKDSLYGSRHLAQIMESIPHSPGPTRIQAIELFVLLDLLGAPSPIFFSHFPRTARWFQRLRS 295

  Fly   250 LELKLFQAGIVRSE-RPLFKFEPGI---DVDDDHLPFTRRNVPVIHLISNKYPAVWHQAEDVEMN 310
            :|.:|.:..:::|. :.:..|:||.   .|:|||:||.||.|||:|||:..:|||||...|.|.|
  Rat   296 IEKRLHRLNLLQSHPQEVMYFQPGEPPGPVEDDHIPFLRRGVPVLHLIAMPFPAVWHTPADTEAN 360

  Fly   311 VDYNTTEQVGLVLRMFVMEYL 331
            :...|...:..:|.:|:.|||
  Rat   361 LHPPTVHNLSRILAVFLAEYL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6168NP_001287032.1 M28_QC_like 49..330 CDD:193501 118/300 (39%)
QpctlNP_001099700.1 M28_QC_like 80..380 CDD:193501 118/300 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338307
Domainoid 1 1.000 47 1.000 Domainoid score I11681
eggNOG 1 0.900 - - E1_KOG3946
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55920
OrthoDB 1 1.010 - - D1257754at2759
OrthoFinder 1 1.000 - - FOG0001509
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12283
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1074
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.820

Return to query results.
Submit another query.